Home » Ataxin-10 » Ataxin-10 Antibodies » Ataxin-10 Antibody

Ataxin-10 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Ataxin-10 Antibody [NBP2-14336] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Western Blot: Ataxin-10 Antibody [NBP2-14336] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Ataxin-10 Antibody [NBP2-14336] - Immunofluorescent staining of human cell line HEK 293 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Ataxin-10 Antibody [NBP2-14336] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Ataxin-10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KHPESEWPFLIITDLFLKSPELVQAMFPKLNNQERVTLLDLMIAKITSDE PLTKDDIPVFLRHAELIASTF
Specificity
Specificity of human Ataxin-10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATXN10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Ataxin-10 Protein (NBP2-14336PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ataxin-10 Antibody

  • ataxin 10
  • ataxin-10
  • Brain protein E46 homolog
  • E46L
  • FLJ37990
  • HUMEEP
  • SCA10spinocerebellar ataxia 10
  • Spinocerebellar ataxia type 10 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Ataxin-3 Antibody
NBP1-32083
Western Blot: Ataxin-3 Antibody [NBP1-32083] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Ataxin 3 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Ataxin-3 Antibody [NBP1-32083] - SK-N-SH cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Ataxin 3 protein stained by Ataxin 3 antibody diluted at 1:250.Blue: Hoechst 33342 staining.
Western Blot: Ataxin-3 Antibody [NBP1-32083] - Various whole cell extracts (30 ug) were separated by 10 % SDS-PAGE, and blotted with Ataxin 3 antibody diluted by 1:1000
Species: Hu
Applications: WB, ICC/IF
Ataxin 1 Antibody
(2F5)
NBP1-51689
Western Blot: Ataxin 1 Antibody (2F5) [NBP1-51689] - Analysis using ATXN1 mab against HEK293 (1) and ATXN1 higGFC transfected HEK293 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: Ataxin 1 Antibody (2F5) [NBP1-51689] - Immunofluorescence analysis of NTERA-2 cells using ATXN1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: Ataxin 1 Antibody (2F5) [NBP1-51689] - Immunohistochemical analysis of paraffin-embedded ovarian cancer tissues (left) and lung cancer tissues (right) using ATXN1 mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
PPP2R2B Antibody
NBP2-46667
Western Blot: PPP2R2B Antibody [NBP2-46667] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: PPP2R2B Antibody [NBP2-46667] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PPP2R2B Antibody [NBP2-46667] - Staining of human cerebral cortex shows distinct cytoplasmic and nuclear positivity in neuronal cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Ataxin 7 Antibody
NBP1-42657
Western Blot: Ataxin 7 Antibody [NBP1-42657] - Whole cell lysate (5, 15 and 50 ug) from 293T cells. Antibody used at 0.4 ug/ml.
(1 Publication)
Species: Hu
Applications: IP (-), WB
Ataxin-2 Antibody
NBP1-90063
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Analysis in human testis and skeletal muscle tissues. Corresponding Ataxin-2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Staining of human cerebellum, cerebral cortex, skeletal muscle and testis using Anti-Ataxin-2 antibody NBP1-90063 (A) shows similar protein distribution across tissues to independent antibody NBP1-90062 (B).
Western Blot: Ataxin-2 Antibody [NBP1-90063] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Ly-6E Antibody
NBP1-52176
Immunocytochemistry/Immunofluorescence: Ly-6E Antibody [NBP1-52176] - Immunofluorescence analysis of paraformaldehyde fixed L929 cells (Mouse fibroblast cell line), permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing membrane staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Flow Cytometry: Ly-6E Antibody [NBP1-52176] - Flow cytometric analysis of paraformaldehyde fixed NIH3T3 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunocytochemistry/Immunofluorescence: Ly-6E Antibody [NBP1-52176] - Immunofluorescence analysis of paraformaldehyde fixed NIH3T3 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing membrane staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(1 Publication)
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA
TATA binding
protein TBP Antibody ...
NBP2-59208
Western Blot: TATA binding protein TBP Antibody (C.15200002) [NBP2-59208] - Whole cell extracts (40 ug) from HeLa cells transfected with TBP siRNA (lane 2) and from an untransfected control (lane 1) were analysed by Western blot using the antibody against TBP diluted 1:500 in TBSTween containing 5% skimmed milk. The position of the protein of interest is indicated on the right; the marker (kDa) is shown on the left.
Chromatin Immunoprecipitation Sequencing: TATA binding protein TBP Antibody (C.15200002) [NBP2-59208] - IP'd DNA was analyzed by QPCR with optimized PCR primer pairs for the promoters of the active GAPDH and c-fos genes, used as positive control targets, and for a region 1 kb upstream of the GAPDH promoter and the coding region of the inactive MB gene, used as negative control targets (A). The IP'd DNA was analyzed with an Illumina Genome Analyzer. Library preparation, cluster generation and sequencing were performed according to the manufacturer's instructions. The 36 bp tags were aligned to the human genome using the ELAND algorithm. Figure shows the peak distribution in 50 kb regions surrounding the GAPDH, c-fos, ACTB and MCL1 genes (B, C, D and E, respectively). These results clearly show a localisation of TBP at the promoters of actively transcribed genes.
Chromatin Immunoprecipitation: TATA binding protein TBP Antibody (C.15200002) [NBP2-59208] - ChIP results obtained with the antibody against TBP. ChIP assays were performed using U2OS cells, the antibody were used per ChIP experiment. QPCR was performed with primers for the promoter of the c-fos and GAPDH genes, a region 0.5 and 1 kb upstream of the GAPDH promoter, respectively, and for exon 2 of the myoglobin gene as a negative control. Figure shows the recovery (the relative amount of immunoprecipitated DNA compared to input DNA) and the occupancy (ratio +/- control target). These results demonstrate the occupancy of both promoters by TBP.
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD
ATN1 Antibody
NBP1-90044
Immunohistochemistry-Paraffin: ATN1 Antibody [NBP1-90044] - Analysis in human cerebral cortex and liver tissues. Corresponding ATN1 RNA-seq data are presented for the same tissues.
Immunocytochemistry/Immunofluorescence: ATN1 Antibody [NBP1-90044] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATN1 Antibody [NBP1-90044] - Staining of human liver shows no positivity in hepatocytes as expected.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PKC gamma Antibody
NBP1-58916
Western Blot: PKC gamma Antibody [NBP1-58916] - Human neuroblastoma cells untreated or treated with various drugs. Image from verified customer review.
Chromatin Immunoprecipitation: PKC gamma Antibody [NBP1-58916] - Quiescent human colon carcinoma cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
Western Blot: PKC gamma Antibody [NBP1-58916] - Human Placenta lysate, concentration 0.2-1 ug/ml.
(1 Review)
Species: Hu
Applications: WB, ChIP, ICC/IF, ChIP
c-Myc Antibody
NB600-335
Western Blot: c-Myc Antibody [NB600-335] - Detection of c-myc-tagged Protein by Western Blot. Samples: 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibodies: Affinity purified, goat anti-c-myc antibody NB600-335 at 0.04 ug/ml (1:25,000). Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunocytochemistry/Immunofluorescence: c-Myc Antibody [NB600-335] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton X-100. The cells were incubated with anti-c-Myc conjugated to Alexa Fluor 488 [NB600-335AF488] at 20 ug/mL for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective. Image using the Alexa Fluor 488 format of this antibody.
Western Blot: c-Myc Antibody [NB600-335] - Analysis using the HRP conjugate of NB600-335. Detection of 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibody used at 0.4 ug/mL (1:25,000).
(1 Review)
(49 Publications)
Species: All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
CCT3 Antibody
NBP1-86562
Western Blot: CCT3 Antibody [NBP1-86562] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-CCT3 antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.
Immunocytochemistry/Immunofluorescence: CCT3 Antibody [NBP1-86562] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CCT3 Antibody [NBP1-86562] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
FGF14 Antibody
NBP3-04588
Western Blot: FGF14 Antibody [NBP3-04588] - Analysis of extracts of various cell lines, using FGF14 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
Immunocytochemistry/Immunofluorescence: FGF14 Antibody [NBP3-04588] - Analysis of U2OS cells using FGF14 antibody.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
PLK1 Antibody
NB100-56651
Western Blot: PLK1 Antibody [NB100-56651] - Analysis of HCT-116 lysate using PLK1 antibody at 1:2000.
Immunohistochemistry-Paraffin: PLK1 Antibody [NB100-56651] - Analysis of human placenta using PLK1 antibody at 1:100.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Spectrin beta 3
Antibody
NB110-58346
Western Blot: Spectrin beta 3 Antibody [NB110-58346] - Detection of Human Spectrin beta 3 on HeLa whole cell lysates using NB110-58346. Spectrin beta 3 was also immunoprecipitated by rabbit anti-Spectrin beta 3 antibody NB110-58783.
Immunohistochemistry-Paraffin: Spectrin beta 3 Antibody [NB110-58346] - Detection of Spectrin beta 3 in human prostate epithelium.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
O-GlcNAc
Transferase p110 subu ...
NBP1-32791
Western Blot: O-GlcNAc Transferase p110 subunit Antibody [NBP1-32791] - Various whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with O-GlcNAc transferase antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: O-GlcNAc Transferase p110 subunit Antibody [NBP1-32791] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: O-GlcNAc transferase protein stained by O- GlcNAc transferase antibody diluted at 1:200. Red: alpha Tubulin, a cytoskeleton marker, stained by alpha Tubulin antibody [GT114] diluted at 1:1000.
Immunohistochemistry-Paraffin: O-GlcNAc Transferase p110 subunit Antibody [NBP1-32791] - Paraffin-embedded rat hind brain. O-GlcNAc transferase antibody diluted at 1:500.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, Tumorsphere
Kv3.3 Antibody
(1C1)
H00003748-M01
Western Blot: Kv3.3 Antibody (1C1) [H00003748-M01] - KCNC3 monoclonal antibody (M01), clone 1C1 Analysis of KCNC3 expression in NIH/3T3.
Immunocytochemistry/Immunofluorescence: Kv3.3 Antibody (1C1) [H00003748-M01] - Analysis of monoclonal antibody to KCNC3 on NIH/3T3 cell. Antibody concentration 10 ug/ml.
(1 Publication)
Species: Hu, Mu, Rb
Applications: WB, ELISA, ICC/IF
IP3R1 Antibody
NBP1-21398
Western Blot: IP3R1 Antibody [NBP1-21398] - Whole cell lysate from HeLa cells. Affinity purified rabbit anti-IP3R1 antibody. IP3R1 was also immunoprecipitated by rabbit anti-IP3R1 antibody NBP1-21397.
Immunohistochemistry-Paraffin: IP3R1 Antibody [NBP1-21398] - Section of mouse cerebellum. Antibody: Affinity purified rabbit anti- IP3R1 used at a dilution of 1:100 (2ug/ml). Detection: Red-fluorescent Goat anti-Rabbit IgG-heavy and light chain cross-adsorbed Antibody DyLight 594 Conjugated used ata dilution of 1:100. Counterstain: DAPI (blue).
Immunohistochemistry-Paraffin: IP3R1 Antibody [NBP1-21398] - Section of mouse cerebellum. Antibody: Affinity purified rabbit anti- IP3R1 used at a dilution of 1:200 (1ug/ml). Detection: DAB. Counterstain: IHC Hematoxylin (blue).
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
Ataxin-10 Antibody
NBP2-14336
Ataxin-10 Antibody
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Ataxin-10 Antibody (NBP2-14336) (0)

There are no publications for Ataxin-10 Antibody (NBP2-14336).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ataxin-10 Antibody (NBP2-14336) (0)

There are no reviews for Ataxin-10 Antibody (NBP2-14336). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ataxin-10 Antibody (NBP2-14336) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Ataxin-10 Products

Bioinformatics Tool for Ataxin-10 Antibody (NBP2-14336)

Discover related pathways, diseases and genes to Ataxin-10 Antibody (NBP2-14336). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ataxin-10 Antibody (NBP2-14336)

Discover more about diseases related to Ataxin-10 Antibody (NBP2-14336).
 

Pathways for Ataxin-10 Antibody (NBP2-14336)

View related products by pathway.

PTMs for Ataxin-10 Antibody (NBP2-14336)

Learn more about PTMs related to Ataxin-10 Antibody (NBP2-14336).

Blogs on Ataxin-10

There are no specific blogs for Ataxin-10, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ataxin-10 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ATXN10