Home » Ataxin-10 » Ataxin-10 Antibodies » Ataxin-10 Antibody

Ataxin-10 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Ataxin-10 Antibody [NBP2-14336] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Western Blot: Ataxin-10 Antibody [NBP2-14336] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Ataxin-10 Antibody [NBP2-14336] - Immunofluorescent staining of human cell line HEK 293 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Ataxin-10 Antibody [NBP2-14336] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Ataxin-10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KHPESEWPFLIITDLFLKSPELVQAMFPKLNNQERVTLLDLMIAKITSDE PLTKDDIPVFLRHAELIASTF
Specificity
Specificity of human Ataxin-10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATXN10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Ataxin-10 Protein (NBP2-14336PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ataxin-10 Antibody

  • ataxin 10
  • ataxin-10
  • Brain protein E46 homolog
  • E46L
  • FLJ37990
  • HUMEEP
  • SCA10spinocerebellar ataxia 10
  • Spinocerebellar ataxia type 10 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Ataxin-3 Antibody
NBP1-32083
Western Blot: Ataxin-3 Antibody [NBP1-32083] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Ataxin 3 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Ataxin-3 Antibody [NBP1-32083] - SK-N-SH cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Ataxin 3 protein stained by Ataxin 3 antibody diluted at 1:250.Blue: Hoechst 33342 staining.
Western Blot: Ataxin-3 Antibody [NBP1-32083] - Various whole cell extracts (30 ug) were separated by 10 % SDS-PAGE, and blotted with Ataxin 3 antibody diluted by 1:1000
Species: Hu
Applications: WB, ICC/IF
Ataxin 1 Antibody
(2F5)
NBP1-51689
Immunocytochemistry/Immunofluorescence: Ataxin 1 Antibody (2F5) [NBP1-51689] - Immunofluorescence analysis of NTERA-2 cells using ATXN1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: Ataxin 1 Antibody (2F5) [NBP1-51689] - Immunohistochemical analysis of paraffin-embedded ovarian cancer tissues (left) and lung cancer tissues (right) using ATXN1 mouse mAb with DAB staining.
Flow Cytometry: Ataxin 1 Antibody (2F5) [NBP1-51689] - Flow cytometric analysis of Jurket cells using ATXN1 mouse mAb (green) and negative control (purple).
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
PEO1 Antibody
NBP1-90814
Immunohistochemistry: PEO1 Antibody [NBP1-90814] - Staining of human pancreas shows cytoplasmic positivity in islet cells.
Species: Hu
Applications: IHC, IHC-P
PPP2R2B Antibody
NBP2-46667
Western Blot: PPP2R2B Antibody [NBP2-46667] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: PPP2R2B Antibody [NBP2-46667] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PPP2R2B Antibody [NBP2-46667] - Staining of human cerebral cortex shows distinct cytoplasmic and nuclear positivity in neuronal cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Ataxin 7 Antibody
NBP1-42657
Western Blot: Ataxin 7 Antibody [NBP1-42657] - Whole cell lysate (5, 15 and 50 ug) from 293T cells. Antibody used at 0.4 ug/ml.
(1 Publication)
Species: Hu
Applications: IP (-), WB
Ataxin-2 Antibody
NBP1-90063
Western Blot: Ataxin-2 Antibody [NBP1-90063] - Analysis in mouse cell line NIH-3T3.
Immunocytochemistry/Immunofluorescence: Ataxin-2 Antibody [NBP1-90063] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Staining of human testis shows high expression.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
CACNA1A Antibody
NBP2-38049
Immunocytochemistry/Immunofluorescence: CACNA1A Antibody [NBP2-38049] - Immunofluorescent staining of human cell line BJ shows localization to nucleoplasm & the Golgi apparatus.
Immunohistochemistry-Paraffin: CACNA1A Antibody [NBP2-38049] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: CACNA1A Antibody [NBP2-38049] - Staining of human cerebral cortex shows high expression.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Ly-6E Antibody
NBP1-52176
Ly-6E Antibody
(1 Publication)
Species: Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
TATA binding
protein TBP Antibody
NBP2-12933
Western Blot: TATA binding protein TBP Antibody [NBP2-12933] - Staining of Pig Testis lysate (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence
Western Blot: TATA binding protein TBP Antibody [NBP2-12933] - NBP2-12933 (1ug/ml) staining of HeLa nuclear (A) and cytosolic (B) lysates (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Western Blot: TATA binding protein TBP Antibody [NBP2-12933] - Analysis of cell line NIH3T3 (A), Mouse Testis (B) and Rat Testis (C) lysates (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
ATN1 Antibody
NBP1-90044
Immunocytochemistry/Immunofluorescence: ATN1 Antibody [NBP1-90044] - Staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ATN1 Antibody [NBP1-90044] - Staining in human cerebral cortex and liver tissues using anti-ATN1 antibody. Corresponding ATN1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ATN1 Antibody [NBP1-90044] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PKC gamma Antibody
NBP1-58916
Western Blot: PKC gamma Antibody [NBP1-58916] - Human neuroblastoma cells untreated or treated with various drugs. Image from verified customer review.
Chromatin Immunoprecipitation: PKC gamma Antibody [NBP1-58916] - Quiescent human colon carcinoma cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
Western Blot: PKC gamma Antibody [NBP1-58916] - Human Placenta lysate, concentration 0.2-1 ug/ml.
(1 Review)
Species: Hu
Applications: WB, ChIP, ICC/IF, ChIP
c-Myc Antibody
NB600-335
Western Blot: c-Myc Antibody [NB600-335] - Detection of c-myc-tagged Protein by Western Blot. Samples: 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibodies: Affinity purified, goat anti-c-myc antibody NB600-335 used for WB at 0.04 ug/ml (1:25,000). Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunocytochemistry/Immunofluorescence: c-Myc Antibody [NB600-335] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-c-Myc conjugated to Alexa Fluor 488 [NB600-335AF488] at 10ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective. Image from the Alexa Fluor 488 version of this antibody.
Western Blot: c-Myc Antibody [NB600-335] - Analysis using the HRP conjugate of NB600-335. Detection of 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibody used for WB at 0.4 ug/ml (1:25,000).
(1 Review)
(38 Publications)
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
CCT3 Antibody
NBP1-86562
Western Blot: CCT3 Antibody [NBP1-86562] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-CCT3 antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.
Immunocytochemistry/Immunofluorescence: CCT3 Antibody [NBP1-86562] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CCT3 Antibody [NBP1-86562] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
FGF14 Antibody
NBP2-55745
Immunocytochemistry/Immunofluorescence: FGF14 Antibody [NBP2-55745] - Staining of human cell line SH-SY5Y shows localization to nucleoli fibrillar center.
Species: Hu
Applications: ICC/IF
PLK1 Antibody
(13E8)
NB100-74502
Western Blot: PLK1 Antibody (13E8) [NB100-74502] - Proteins were transferred to a PVDF membrane and blocked with 5% Milk/TBST for at least 1 hour. Membranes were probed with PLK1 mouse monoclonal antibody at a dilution of 1:1000 overnight at 4C on a rocking platform. Membranes were washed in TBS-0.1%Tween 20 and probed with a goat anti-mouse-HRP secondary antibody at a dilution of 1:20,000 for at least one hour. Membranes were washed and chemiluminescent detection performed.
Immunocytochemistry/Immunofluorescence: PLK1 Antibody (13E8) [NB100-74502] - PLK1 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) in WiDr colon carcinoma cells. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing PLK1 at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: PLK1 Antibody (13E8) [NB100-74502] - Both normal and cancer biopsies of deparaffinized human Colon tissue.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Spectrin beta 3
Antibody (3B1NB)
NBP2-44310
Immunocytochemistry/Immunofluorescence: Spectrin beta 3 Antibody (3B1NB) [NBP2-44310] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-Spectrin beta 3 (3B1NB) conjugated to Alexa Fluor 488 [NBP2-44310AF488] at 10ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Spectrin beta 3 Antibody (3B1NB) [NBP2-44310] - IHC analysis of a formalin fixed and paraffin embedded tissue section of normal human prostate using 1:200 dilution of Spectrin beta 3 antibody (clone 3B1NB). The antibody generated a specific cytoplasmic staining with strong signal at cell-cell junctions in the glandular epithelium of the prostate section. The cells of fibromuscular stroma showed a diffused signal throughout the sections.
Flow (Cell Surface): Spectrin beta 3 Antibody (3B1NB) [NBP2-44310] - Analysis using the Azide Free version of NBP2-44310. Detection of HeLa cells (1 x 10^6 cells/ml) at a 1:500 dilution detected using Dylight-488 conjugated goat anti-rat IgG secondary antibody (blue peak). Shown with secondary control (orange peak).
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, Flow-CS
O-GlcNAc
Transferase p110 subu ...
NBP1-32791
Western Blot: O-GlcNAc Transferase p110 subunit Antibody [NBP1-32791] - Mouse tissue extracts (50 ug) was separated by 7.5 % SDS-PAGE, and blotted with O-GlcNAc transferase antibody diluted by 1:2000
Immunocytochemistry/Immunofluorescence: O-GlcNAc Transferase p110 subunit Antibody [NBP1-32791] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: O-GlcNAc transferase protein stained by O- GlcNAc transferase antibody (GTX109939) diluted at 1:200.Red: alpha Tubulin, a cytoskeleton marker, stained by alpha Tubulin antibody [GT114] diluted at 1:1000.
Immunohistochemistry-Paraffin: O-GlcNAc Transferase p110 subunit Antibody [NBP1-32791] - Paraffin-embedded rat hind brain. O-GlcNAc transferase antibody diluted at 1:500.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Kv3.3 Antibody
(1C1)
H00003748-M01
Western Blot: Kv3.3 Antibody (1C1) [H00003748-M01] - KCNC3 monoclonal antibody (M01), clone 1C1 Analysis of KCNC3 expression in NIH/3T3.
Immunocytochemistry/Immunofluorescence: Kv3.3 Antibody (1C1) [H00003748-M01] - Analysis of monoclonal antibody to KCNC3 on NIH/3T3 cell. Antibody concentration 10 ug/ml.
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
IP3R1 Antibody
NBP1-21398
Western Blot: IP3R1 Antibody [NBP1-21398] - Whole cell lysate from HeLa cells. Affinity purified rabbit anti-IP3R1 antibody. IP3R1 was also immunoprecipitated by rabbit anti-IP3R1 antibody NBP1-21397.
Immunohistochemistry: IP3R1 Antibody [NBP1-21398] - Sample: FFPE section of mouse cerebellum. Antibody: Affinity purified rabbit anti- IP3R1 used at a dilution of 1:200 (1ug/ml). Detection: DAB. Counterstain: IHC Hematoxylin (blue).
Immunohistochemistry: IP3R1 Antibody [NBP1-21398] - Sample: FFPE section of mouse cerebellum. Antibody: Affinity purified rabbit anti- IP3R1 used at a dilution of 1:100 (2ug/ml). Detection: Red-fluorescent Goat anti-Rabbit IgG-heavy and light chain cross-adsorbed Antibody DyLight 594 Conjugated (A120-601D4
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
Ataxin-10 Antibody
NBP2-14336
Ataxin-10 Antibody
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Ataxin-10 Antibody (NBP2-14336) (0)

There are no publications for Ataxin-10 Antibody (NBP2-14336).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ataxin-10 Antibody (NBP2-14336) (0)

There are no reviews for Ataxin-10 Antibody (NBP2-14336). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ataxin-10 Antibody (NBP2-14336) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Ataxin-10 Antibody (NBP2-14336)

Discover related pathways, diseases and genes to Ataxin-10 Antibody (NBP2-14336). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ataxin-10 Antibody (NBP2-14336)

Discover more about diseases related to Ataxin-10 Antibody (NBP2-14336).
 

Pathways for Ataxin-10 Antibody (NBP2-14336)

View related products by pathway.

PTMs for Ataxin-10 Antibody (NBP2-14336)

Learn more about PTMs related to Ataxin-10 Antibody (NBP2-14336).

Blogs on Ataxin-10

There are no specific blogs for Ataxin-10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ataxin-10 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ATXN10