Ataxin-10 Antibody

Images

 
Western Blot: Ataxin-10 Antibody [NBP2-14336] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Ataxin-10 Antibody [NBP2-14336] - Immunofluorescent staining of human cell line HEK 293 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Ataxin-10 Antibody [NBP2-14336] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ataxin-10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KHPESEWPFLIITDLFLKSPELVQAMFPKLNNQERVTLLDLMIAKITSDE PLTKDDIPVFLRHAELIASTF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATXN10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Ataxin-10 Protein (NBP2-14336PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ataxin-10 Antibody

  • ataxin 10
  • ataxin-10
  • Brain protein E46 homolog
  • E46L
  • FLJ37990
  • HUMEEP
  • SCA10spinocerebellar ataxia 10
  • Spinocerebellar ataxia type 10 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-90814
Species: Hu
Applications: IHC, IHC-P
NBP2-46667
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-42657
Species: Hu
Applications: IP (-), WB
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00004061-D01P
Species: Hu
Applications: WB
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
AF6567
Species: Hu, Mu
Applications: WB, IHC
AF5130
Species: Hu, Mu, Rt
Applications: WB
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-86562
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55745
Species: Hu
Applications: ICC/IF
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NB110-58346
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-32791
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00003748-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC-P, IP, IF
NBP2-14336
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Ataxin-10 Antibody (NBP2-14336) (0)

There are no publications for Ataxin-10 Antibody (NBP2-14336).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ataxin-10 Antibody (NBP2-14336) (0)

There are no reviews for Ataxin-10 Antibody (NBP2-14336). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ataxin-10 Antibody (NBP2-14336) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ataxin-10 Products

Bioinformatics Tool for Ataxin-10 Antibody (NBP2-14336)

Discover related pathways, diseases and genes to Ataxin-10 Antibody (NBP2-14336). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ataxin-10 Antibody (NBP2-14336)

Discover more about diseases related to Ataxin-10 Antibody (NBP2-14336).
 

Pathways for Ataxin-10 Antibody (NBP2-14336)

View related products by pathway.

PTMs for Ataxin-10 Antibody (NBP2-14336)

Learn more about PTMs related to Ataxin-10 Antibody (NBP2-14336).

Blogs on Ataxin-10

There are no specific blogs for Ataxin-10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ataxin-10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATXN10