Ataxin-2 Antibody

Images

 
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90062] - Staining of human colon.
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90062] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in purkinje cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90062] - Immunohistochemistry analysis in human testis and skeletal muscle tissues. Corresponding RNA-seq data are presented for the ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90062] - Staining of human colon, kidney, skeletal muscle and testis using Anti-ATXN2 antibody NBP1-90062 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90062] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in purkinje cells.
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90062] - Staining of human skeletal muscle shows weak to moderate cytoplasmic positivity in a subset of myocytes.
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90062] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90062] - Staining of human kidney.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ataxin-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EGHSINTRENKYIPPGQRNREVISWGSGRQNSPRMGQPGSGSMPSRSTSHTSDFNPNSGSDQRVVNGGVPWPSPCPSPSSRPPSRYQSGPNSLPPRAATPTRPPSRPPSRPSRPPSHPSAHGSPAPVSTMPKRMSSE
Specificity
Specificity of human Ataxin-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATXN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publication using NBP1-90062.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23209657)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ataxin-2 Antibody

  • ataxin 2
  • ataxin 2)
  • ataxin-2
  • ATX2spinocerebellar ataxia 2 (olivopontocerebellar ataxia 2, autosomal dominant
  • SCA2FLJ46772
  • Spinocerebellar ataxia type 2 protein
  • TNRC13
  • trinucleotide repeat containing 13
  • Trinucleotide repeat-containing gene 13 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NBP1-51689
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-38049PEP
Species: Hu
Applications: AC
NBP1-42657
Species: Hu
Applications: WB, IP
NBP1-90044
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, ChIP, CHIP-SEQ, KD
NBP1-57356
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NBP2-46667
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75531
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-14336
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00023435-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF1436
Species: Mu
Applications: WB
NBP2-13169
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP2-56984
Species: Hu
Applications: ICC/IF
NBP1-91500
Species: Hu, Mu, Rt
Applications: WB
NBP2-59668
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, Flow-IC
H00006532-D01P
Species: Hu, Mu
Applications: WB, Flow

Publications for Ataxin-2 Antibody (NBP1-90062)(1)


Reviews for Ataxin-2 Antibody (NBP1-90062) (0)

There are no reviews for Ataxin-2 Antibody (NBP1-90062). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Ataxin-2 Antibody (NBP1-90062) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Ataxin-2 Products

Bioinformatics Tool for Ataxin-2 Antibody (NBP1-90062)

Discover related pathways, diseases and genes to Ataxin-2 Antibody (NBP1-90062). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ataxin-2 Antibody (NBP1-90062)

Discover more about diseases related to Ataxin-2 Antibody (NBP1-90062).
 

Pathways for Ataxin-2 Antibody (NBP1-90062)

View related products by pathway.

PTMs for Ataxin-2 Antibody (NBP1-90062)

Learn more about PTMs related to Ataxin-2 Antibody (NBP1-90062).
 

Research Areas for Ataxin-2 Antibody (NBP1-90062)

Find related products by research area.

Blogs on Ataxin-2

There are no specific blogs for Ataxin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ataxin-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATXN2