FGF14 Antibody


Western Blot: FGF14 Antibody [NBP1-69006] - Human Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

FGF14 Antibody Summary

Synthetic peptides corresponding to FGF14 (fibroblast growth factor 14) The peptide sequence was selected from the middle region of FGF14. Peptide sequence ENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKP.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FGF14 and was validated on Western blot.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FGF14 Antibody

  • bA397O8.2
  • FGF-14
  • FHF4FHF-4
  • fibroblast growth factor 14
  • Fibroblast growth factor homologous factor 4
  • SCA27MGC119129


The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. A mutation in this gene is associated with autosomal dominant cerebral ataxia. Alternatively spliced transcript variants have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ChIP, ICC/IF, ChIP
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for FGF14 Antibody (NBP1-69006) (0)

There are no publications for FGF14 Antibody (NBP1-69006).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF14 Antibody (NBP1-69006) (0)

There are no reviews for FGF14 Antibody (NBP1-69006). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGF14 Antibody (NBP1-69006) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FGF14 Products

Bioinformatics Tool for FGF14 Antibody (NBP1-69006)

Discover related pathways, diseases and genes to FGF14 Antibody (NBP1-69006). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF14 Antibody (NBP1-69006)

Discover more about diseases related to FGF14 Antibody (NBP1-69006).

Pathways for FGF14 Antibody (NBP1-69006)

View related products by pathway.

PTMs for FGF14 Antibody (NBP1-69006)

Learn more about PTMs related to FGF14 Antibody (NBP1-69006).

Research Areas for FGF14 Antibody (NBP1-69006)

Find related products by research area.

Blogs on FGF14

There are no specific blogs for FGF14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FGF14 Antibody and receive a gift card or discount.


Gene Symbol FGF14