CACNA1A Antibody

Images

 
Immunohistochemistry-Paraffin: CACNA1A Antibody [NBP3-17155] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CACNA1A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: APATYEGDARREDKERRHRRRKENQGSGVPVSGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNKLATAESAAPHGSLGHAGLPQSPAKMGNRTDP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CACNA1A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CACNA1A Antibody

  • APCA
  • BI
  • brain calcium channel 1
  • Brain calcium channel I
  • CACH4
  • CACN3
  • CACNL1A4CAV2.1
  • Calcium channel, L type, alpha-1 polypeptide isoform 4
  • calcium channel, L type, alpha-1 polypeptide
  • calcium channel, voltage-dependent, P/Q type, alpha 1A subunit
  • Cav2.1
  • EA2
  • FHM
  • HPCA
  • MHP
  • MHP1
  • SCA6
  • voltage-dependent P/Q-type calcium channel subunit alpha-1A
  • Voltage-gated calcium channel subunit alpha Cav2.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-104
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PLA, Simple Western, WB
NBP2-92853
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-90063
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-51843
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-52176
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA
NBP1-42657
Species: Hu
Applications: IP (-), WB
NBP2-94669
Species: Hu, Mu, Rt
Applications: WB
NBP2-76923
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB400-144
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-91744
Species: Hu
Applications: IHC, IHC-P
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
NB110-68133
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-19491
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
H00051531-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
NBP3-17155
Species: Hu
Applications: IHC, IHC-P

Publications for CACNA1A Antibody (NBP3-17155) (0)

There are no publications for CACNA1A Antibody (NBP3-17155).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CACNA1A Antibody (NBP3-17155) (0)

There are no reviews for CACNA1A Antibody (NBP3-17155). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CACNA1A Antibody (NBP3-17155) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CACNA1A Products

Bioinformatics Tool for CACNA1A Antibody (NBP3-17155)

Discover related pathways, diseases and genes to CACNA1A Antibody (NBP3-17155). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACNA1A Antibody (NBP3-17155)

Discover more about diseases related to CACNA1A Antibody (NBP3-17155).
 

Pathways for CACNA1A Antibody (NBP3-17155)

View related products by pathway.

PTMs for CACNA1A Antibody (NBP3-17155)

Learn more about PTMs related to CACNA1A Antibody (NBP3-17155).
 

Research Areas for CACNA1A Antibody (NBP3-17155)

Find related products by research area.

Blogs on CACNA1A

There are no specific blogs for CACNA1A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CACNA1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNA1A