CACNA1A Antibody

Images

 
Immunohistochemistry-Paraffin: CACNA1A Antibody [NBP3-17155] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CACNA1A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: APATYEGDARREDKERRHRRRKENQGSGVPVSGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNKLATAESAAPHGSLGHAGLPQSPAKMGNRTDP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CACNA1A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CACNA1A Antibody

  • APCA
  • BI
  • brain calcium channel 1
  • Brain calcium channel I
  • CACH4
  • CACN3
  • CACNL1A4CAV2.1
  • Calcium channel, L type, alpha-1 polypeptide isoform 4
  • calcium channel, L type, alpha-1 polypeptide
  • calcium channel, voltage-dependent, P/Q type, alpha 1A subunit
  • Cav2.1
  • EA2
  • FHM
  • HPCA
  • MHP
  • MHP1
  • SCA6
  • voltage-dependent P/Q-type calcium channel subunit alpha-1A
  • Voltage-gated calcium channel subunit alpha Cav2.1

Background

FUNCTION: Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1A gives rise to P and/or Q-type calcium currents. P/Q-type calcium channels belong to the 'high-voltage activated' (HVA) group and are blocked by the funnel toxin (Ftx) and by the omega-agatoxin-IVA (omega-Aga-IVA). They are however insensitive to dihydropyridines (DHP), and omega-conotoxin-GVIA (omega-CTx-GVIA).; SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein.; Tissue specificity: Brain specific; mainly found in cerebellum, cerebral cortex, thalamus and hypothalamus. No expression in heart, kidney, liver or muscle. Purkinje cells contain predominantly P-type VSCC, the Q-type being a prominent calcium current in cerebellar granule cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CACNA1A Antibody (NBP3-17155) (0)

There are no publications for CACNA1A Antibody (NBP3-17155).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CACNA1A Antibody (NBP3-17155) (0)

There are no reviews for CACNA1A Antibody (NBP3-17155). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CACNA1A Antibody (NBP3-17155) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CACNA1A Products

Research Areas for CACNA1A Antibody (NBP3-17155)

Find related products by research area.

Blogs on CACNA1A

There are no specific blogs for CACNA1A, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CACNA1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNA1A