Ataxin 1 Antibody (S76-8) [Alexa Fluor® 350] Summary
| Description |
This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. All conjugates are generated using validated conjugation protocols and meet strict degree of labeling (F/P) specifications; additional information is available upon request. The antibody concentration is provided on the individual product label.
For specialized conjugation needs, like large quantities, specific concentrations, and defined F/P ratios, bulk and custom antibody conjugation services are available. |
| Immunogen |
Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). |
| Localization |
Cytoplasm , Nucleus |
| Specificity |
Detects approx 85kDa. |
| Isotype |
IgG2b |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
ATXN1 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunoprecipitation
- Western Blot
|
| Application Notes |
Recommended applications are based on validated applications from the unconjugated base product NBP2-42186. This conjugated antibody is not kept in inventory and is made to order using validated conjugation protocols. |
Reactivity Notes
Immunogen displays sequence identity for non-tested species: Human and Rat.
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Protein G purified |
Notes
Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
Alternate Names for Ataxin 1 Antibody (S76-8) [Alexa Fluor® 350]
Background
Defects in Ataxin-1 are the cause of spinocerebellar ataxia type 1 (SCA1), also known as olivopontocerebellar atrophy I (OPCA I or OPCA1). Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to cerebellum degeneration with variable involvement of the brainstem and spinal cord. SCA1 is caused by expansion of a CAG repeat in the coding region of the ataxin-1 gene. Longer expansions result in earlier onset and more severe clinical manifestations of the disease. Ataxin-1 binds RNA in vitro and may be involved in RNA metabolism. [Uniprot]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IP (-), WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu(-), Mu
Applications: COMET, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, mIF, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
Publications for Ataxin 1 Antibody (NBP2-42186AF350) (0)
There are no publications for Ataxin 1 Antibody (NBP2-42186AF350).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Ataxin 1 Antibody (NBP2-42186AF350) (0)
There are no reviews for Ataxin 1 Antibody (NBP2-42186AF350).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Ataxin 1 Antibody (NBP2-42186AF350) (0)