Ataxin 1 Antibody (S76-8) [DyLight 680]


There are currently no images for Ataxin 1 Antibody (NBP2-42186FR).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Reactivity MuSpecies Glossary
Applications WB, IHC
DyLight 680

Ataxin 1 Antibody (S76-8) [DyLight 680] Summary

Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
Cytoplasm, Nucleus
Detects approx 85kDa.
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunohistochemistry
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Reactivity Notes

Based on homology, It's predicted to detect Human and Rat.

Packaging, Storage & Formulations

Store at 4C in the dark.
50mM Sodium Borate
0.05% Sodium Azide
Protein G purified



Alternate Names for Ataxin 1 Antibody (S76-8) [DyLight 680]

  • ataxin 1
  • ataxin 1)
  • ataxin-1
  • ATX1spinocerebellar ataxia 1 (olivopontocerebellar ataxia 1, autosomal dominant
  • SCA1D6S504E
  • Spinocerebellar ataxia type 1 protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IP (-), WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Ataxin 1 Antibody (NBP2-42186FR) (0)

There are no publications for Ataxin 1 Antibody (NBP2-42186FR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ataxin 1 Antibody (NBP2-42186FR) (0)

There are no reviews for Ataxin 1 Antibody (NBP2-42186FR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ataxin 1 Antibody (NBP2-42186FR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Ataxin 1 Antibody (NBP2-42186FR)

Discover related pathways, diseases and genes to Ataxin 1 Antibody (NBP2-42186FR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ataxin 1 Antibody (NBP2-42186FR)

Discover more about diseases related to Ataxin 1 Antibody (NBP2-42186FR).

Pathways for Ataxin 1 Antibody (NBP2-42186FR)

View related products by pathway.

PTMs for Ataxin 1 Antibody (NBP2-42186FR)

Learn more about PTMs related to Ataxin 1 Antibody (NBP2-42186FR).

Research Areas for Ataxin 1 Antibody (NBP2-42186FR)

Find related products by research area.

Blogs on Ataxin 1.

ATXN2 Identified as New Genetic Risk Factor for Lou Gehrig's Disease (ALS)
Ataxin antibodies are used in the study of autosomal dominant cerebellar ataxia (ADCA) diseases. These neurodegenerative disorders are highly heterogeneous, characterized by progressive, irreversible, atrophy of the cerebellum and spinal cord.Ataxin...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Ataxin 1 Antibody (S76-8) [DyLight 680] and receive a gift card or discount.


Gene Symbol ATXN1