We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Ataxin 1 Antibody (S76-8) [Alexa Fluor™ Plus 555]

Images

 
There are currently no images for Ataxin 1 Antibody (NBP2-42186AFP555).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IP
Clone
S76-8
Clonality
Monoclonal
Host
Mouse
Conjugate
Alexa Fluor Plus 555

Order Details

Ataxin 1 Antibody (S76-8) [Alexa Fluor™ Plus 555] Summary

Description
This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. All conjugates are generated using validated conjugation protocols and meet strict degree of labeling (F/P) specifications; additional information is available upon request. The antibody concentration is provided on the individual product label.

For specialized conjugation needs, like large quantities, specific concentrations, and defined F/P ratios, bulk and custom antibody conjugation services are available.
Immunogen
Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
Localization
Cytoplasm , Nucleus
Specificity
Detects approx 85kDa.
Isotype
IgG2b
Clonality
Monoclonal
Host
Mouse
Gene
ATXN1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunoprecipitation
  • Western Blot
Application Notes
Recommended applications are based on validated applications from the unconjugated base product NBP2-42186. This conjugated antibody is not kept in inventory and is made to order using validated conjugation protocols.

Reactivity Notes

Immunogen displays sequence identity for non-tested species: Human and Rat.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein G purified

Notes



This product is provided under an intellectual property license from Life Technologies Corporation. The transfer of this product is conditioned on the buyer using the purchased product solely in research conducted by the buyer, excluding contract research or any fee for service research, and the buyer must not (1) use this product or its components for (a) diagnostic, therapeutic or prophylactic purposes; (b) testing, analysis or screening services, or information in return for compensation on a per-test basis; or (c) manufacturing or quality assurance or quality control, and/or (2) sell or transfer this product or its components for resale, whether or not resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5781 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@thermofisher.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Ataxin 1 Antibody (S76-8) [Alexa Fluor™ Plus 555]

  • ataxin 1
  • ataxin 1)
  • ataxin-1
  • ATX1spinocerebellar ataxia 1 (olivopontocerebellar ataxia 1, autosomal dominant
  • SCA1D6S504E
  • Spinocerebellar ataxia type 1 protein

Background

Defects in Ataxin-1 are the cause of spinocerebellar ataxia type 1 (SCA1), also known as olivopontocerebellar atrophy I (OPCA I or OPCA1). Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to cerebellum degeneration with variable involvement of the brainstem and spinal cord. SCA1 is caused by expansion of a CAG repeat in the coding region of the ataxin-1 gene. Longer expansions result in earlier onset and more severe clinical manifestations of the disease. Ataxin-1 binds RNA in vitro and may be involved in RNA metabolism. [Uniprot]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-25371
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-90063
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-52176
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA
NBP3-17155
Species: Hu
Applications: IHC,  IHC-P
NBP1-42657
Species: Hu
Applications: IP (-), WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-15642
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
NBP2-46667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-1071
Species: Hu(-), Mu
Applications: COMET, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, mIF, WB
H00002523-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-59478
Species: Hu
Applications: ELISA, ICC/IF, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NBP3-05546
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-06611
Species: Hu
Applications: ICC/IF, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP2-14336
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-42186AFP555
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP

Publications for Ataxin 1 Antibody (NBP2-42186AFP555) (0)

There are no publications for Ataxin 1 Antibody (NBP2-42186AFP555).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ataxin 1 Antibody (NBP2-42186AFP555) (0)

There are no reviews for Ataxin 1 Antibody (NBP2-42186AFP555). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ataxin 1 Antibody (NBP2-42186AFP555) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ataxin 1 Products

Research Areas for Ataxin 1 Antibody (NBP2-42186AFP555)

Find related products by research area.

Blogs on Ataxin 1.

ATXN2 Identified as New Genetic Risk Factor for Lou Gehrig's Disease (ALS)
Ataxin antibodies are used in the study of autosomal dominant cerebellar ataxia (ADCA) diseases. These neurodegenerative disorders are highly heterogeneous, characterized by progressive, irreversible, atrophy of the cerebellum and spinal cord.Ataxin...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ataxin 1 Antibody (S76-8) [Alexa Fluor™ Plus 555] and receive a gift card or discount.

Bioinformatics

Gene Symbol ATXN1