Ataxin 1 Antibody (S76-8) [mFluor Violet 610 SE]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IP
• Clone: S76-8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: mFluor Violet 610 SE

Ataxin 1 Antibody (S76-8) [mFluor Violet 610 SE] Summary

• Description: This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. All conjugates are generated using validated conjugation protocols and meet strict degree of labeling (F/P) specifications; additional information is available upon request. The antibody concentration is provided on the individual product label.
  
  For specialized conjugation needs, like large quantities, specific concentrations, and defined F/P ratios, bulk and custom antibody conjugation services are available.
• Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
• Localization: Cytoplasm , Nucleus
• Specificity: Detects approx 85kDa.
• Isotype: IgG2b
• Clonality: Monoclonal
• Host: Mouse
• Gene: ATXN1
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunoprecipitation
  • Western Blot
• Application Notes: Recommended applications are based on validated applications from the unconjugated base product NBP2-42186. This conjugated antibody is not kept in inventory and is made to order using validated conjugation protocols.

Reactivity Notes

Immunogen displays sequence identity for non-tested species: Human and Rat.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Protein G purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Ataxin 1 Antibody (S76-8) [mFluor Violet 610 SE]

• ataxin 1
• ataxin 1)
• ataxin-1
• ATX1spinocerebellar ataxia 1 (olivopontocerebellar ataxia 1, autosomal dominant
• SCA1D6S504E
• Spinocerebellar ataxia type 1 protein

Background

Defects in Ataxin-1 are the cause of spinocerebellar ataxia type 1 (SCA1), also known as olivopontocerebellar atrophy I (OPCA I or OPCA1). Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to cerebellum degeneration with variable involvement of the brainstem and spinal cord. SCA1 is caused by expansion of a CAG repeat in the coding region of the ataxin-1 gene. Longer expansions result in earlier onset and more severe clinical manifestations of the disease. Ataxin-1 binds RNA in vitro and may be involved in RNA metabolism. [Uniprot]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATXN1