Asparagine synthetase Antibody - BSA Free

Western Blot: Asparagine synthetase Antibody [NBP2-56407] - Analysis in human cell line U-87 MG.

Immunocytochemistry/Immunofluorescence: Asparagine synthetase Antibody [NBP2-56407] - Staining of human cell line MCF7 shows localization to cytosol. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Asparagine synthetase Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKKMQ
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ASNS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Asparagine synthetase Recombinant Protein Antigen (NBP2-56407PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Asparagine synthetase Antibody - BSA Free

• ASNS
• ASNSD
• asparagine synthetase (glutamine-hydrolyzing)
• asparagine synthetase [glutamine-hydrolyzing]
• asparagine synthetase
• Cell cycle control protein TS11
• EC 6.3.5.4
• Glutamine Dependent Asparagine Synthetase
• Glutamine-dependent asparagine synthetase
• TS11 Cell Cycle Control Protein
• TS11

Background

Asparagine synthetase (AS) is a housekeeping enzyme responsible for the production of asparagine from aspartate and glutamine. Most mammalian cells express AS and regulate the level of activity in response to the concentration of asparagine in the medium. Certain tumor cells in contrast, exhibit little or no AS activity and rely on the surrounding medium as a source of exogenous asparagines (1). Therefore tumor cells may be selectively killed by a chemotherapeutic drug using asparaginase. This approach has been exploited in the treatment of certain cancers like childhood acute lymphoblastic leukemia (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ASNS