CAT1 Antibody (2B9)

Images

 
Western Blot: CAT1 Antibody (2B9) [H00006541-M02] - Since miRNA214 is upregulated and miRNA 378 is downregulated following 12 days of TAC, western immunoblotting was carried out for nodal molecule (NF kappa B) and other ...read more
Western Blot: CAT1 Antibody (2B9) [H00006541-M02] - Analysis of SLC7A1 expression in transfected 293T cell line by SLC7A1 monoclonal antibody (M02), clone 2B9.Lane 1: SLC7A1 transfected lysate (Predicted MW: 67.6 ...read more
Sandwich ELISA: CAT1 Antibody (2B9) [H00006541-M02] - Detection limit for recombinant GST tagged SLC7A1 is 0.03 ng/ml as a capture antibody.
A. Since miRNA214 is upregulated and miRNA 378 is downregulated following 12 days of TAC, western immunoblotting was carried out for nodal molecule (NF kappa B) and other network molecules (HDGF, BCL2 and SLC7A1). GAPDH ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA
Clone
2B9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CAT1 Antibody (2B9) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
SLC7A1 (NP_003036, 431 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKIS
Specificity
Reacts with solute carrier family 7 (cationic amino acid transporter, y+ system), member 1.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC7A1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Reactivity Notes

Mouse data from journals.plos.org/plosone/article?id=10.1371/journal.pone.0170456.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CAT1 Antibody (2B9)

  • amino acid transporter, cationic 1
  • ATRC1
  • ATRC1ERR
  • CAT1
  • CAT-1System Y+ basic amino acid transporter
  • Ecotropic retroviral leukemia receptor homolog
  • ecotropic retroviral receptor
  • Ecotropic retrovirus receptor homolog
  • HCAT1
  • high affinity cationic amino acid transporter 1
  • REC1L
  • REC1LCAT1
  • SLC7A1
  • solute carrier family 7 (cationic amino acid transporter, y+ system), member 1
  • Solute carrier family 7 member 1

Background

High-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. May also function as an ecotropic retroviral leukemia receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-16661
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP2-93699
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-93520
Species: Hu
Applications: PEP-ELISA, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-74144
Species: Mu
Applications: WB
NBP1-47254
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PP-H6812-00
Species: Hu
Applications: DirELISA, IHC, IP, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NBP2-32372
Species: Hu, Rt
Applications: IHC, IHC-P
NBP2-75086
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NB100-858
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
NBP2-80662
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P, WB
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86613
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-82826
Species: Hu
Applications: IHC, IHC-P, WB
H00006541-M02
Species: Hu, Mu
Applications: WB, ELISA

Publications for CAT1 Antibody (H00006541-M02) (0)

There are no publications for CAT1 Antibody (H00006541-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAT1 Antibody (H00006541-M02) (0)

There are no reviews for CAT1 Antibody (H00006541-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CAT1 Antibody (H00006541-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CAT1 Antibody (2B9) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC7A1
Entrez
Uniprot