CAT1 Antibody (2B9)

Images

 
Western Blot: CAT1 Antibody (2B9) [H00006541-M02] - Analysis of SLC7A1 expression in transfected 293T cell line by SLC7A1 monoclonal antibody (M02), clone 2B9.Lane 1: SLC7A1 transfected lysate (Predicted MW: 67.6 ...read more
Sandwich ELISA: CAT1 Antibody (2B9) [H00006541-M02] - Detection limit for recombinant GST tagged SLC7A1 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2B9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CAT1 Antibody (2B9) Summary

Immunogen
SLC7A1 (NP_003036 431 a.a. - 492 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKIS
Specificity
Reacts with solute carrier family 7 (cationic amino acid transporter, y+ system), member 1.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC7A1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CAT1 Antibody (2B9)

  • amino acid transporter, cationic 1
  • ATRC1
  • ATRC1ERR
  • CAT1
  • CAT-1System Y+ basic amino acid transporter
  • Ecotropic retroviral leukemia receptor homolog
  • ecotropic retroviral receptor
  • Ecotropic retrovirus receptor homolog
  • HCAT1
  • high affinity cationic amino acid transporter 1
  • REC1L
  • REC1LCAT1
  • SLC7A1
  • solute carrier family 7 (cationic amino acid transporter, y+ system), member 1
  • Solute carrier family 7 member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00009815-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-58924
Species: Hu
Applications: ICC/IF
NB100-93520
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-78911
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47254
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H6812-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP2-30868
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP2-36491
Species: Hu
Applications: WB, Flow, IHC, IHC-P, Flow-CS
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
H00009056-B01P
Species: Hu, Rt
Applications: WB
H00006541-M02
Species: Hu
Applications: WB, ELISA

Publications for CAT1 Antibody (H00006541-M02) (0)

There are no publications for CAT1 Antibody (H00006541-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAT1 Antibody (H00006541-M02) (0)

There are no reviews for CAT1 Antibody (H00006541-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CAT1 Antibody (H00006541-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CAT1 Products

Bioinformatics Tool for CAT1 Antibody (H00006541-M02)

Discover related pathways, diseases and genes to CAT1 Antibody (H00006541-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CAT1 Antibody (H00006541-M02)

Discover more about diseases related to CAT1 Antibody (H00006541-M02).
 

Pathways for CAT1 Antibody (H00006541-M02)

View related products by pathway.

PTMs for CAT1 Antibody (H00006541-M02)

Learn more about PTMs related to CAT1 Antibody (H00006541-M02).

Blogs on CAT1

There are no specific blogs for CAT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CAT1 Antibody (2B9) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC7A1
Entrez
Uniprot