ASGPR1 Antibody Summary
Immunogen |
Synthetic peptides corresponding to ASGR1 (asialoglycoprotein receptor 1) The peptide sequence was selected from the N terminal of ASGR1. Peptide sequence RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS. The peptide sequence for this immunogen was taken from within the described region. |
Predicted Species |
Mouse (91%), Rat (92%), Porcine (93%), Guinea Pig (92%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ASGR1 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:100-1:2000
- Immunohistochemistry
|
Application Notes |
This is a rabbit polyclonal antibody against ASGR1 and was validated on Western blot. |
Theoretical MW |
33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Purity |
Protein A purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for ASGPR1 Antibody
Background
ASGR1 encodes for a cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
Species: Hu, Mu, Rt, Po, Gp
Applications: WB, IHC
Publications for ASGPR1 Antibody (NBP1-54385) (0)
There are no publications for ASGPR1 Antibody (NBP1-54385).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ASGPR1 Antibody (NBP1-54385) (0)
There are no reviews for ASGPR1 Antibody (NBP1-54385).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ASGPR1 Antibody (NBP1-54385) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional ASGPR1 Products
Bioinformatics Tool for ASGPR1 Antibody (NBP1-54385)
Discover related pathways, diseases and genes to ASGPR1 Antibody (NBP1-54385). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for ASGPR1 Antibody (NBP1-54385)
Discover more about diseases related to ASGPR1 Antibody (NBP1-54385).
| | Pathways for ASGPR1 Antibody (NBP1-54385)
View related products by pathway.
|
Blogs on ASGPR1