ASGPR1 Antibody


Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Jurkat Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Liver, concentration 0.6ug/ml.
Western Blot: ASGPR1 Antibody [NBP1-54385] - Tissue: HepG2.
Western Blot: ASGPR1 Antibody [NBP1-54385] - Tissue: MCF7.
Western Blot: ASGPR1 Antibody [NBP1-54385] - Tissue: Human Fetal Heart.
Western Blot: ASGPR1 Antibody [NBP1-54385] - Tissue: Human Fetal Kidney.
Western Blot: ASGPR1 Antibody [NBP1-54385] - Tissue: 293T.
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Tissue: Human Stomach Tumor Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Human Fetal Kidney Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC

Order Details

ASGPR1 Antibody Summary

Synthetic peptides corresponding to ASGR1 (asialoglycoprotein receptor 1) The peptide sequence was selected from the N terminal of ASGR1. Peptide sequence RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against ASGR1 and was validated on Western blot.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ASGPR1 Antibody

  • ASGPR 1
  • ASGP-R 1
  • ASGPR1
  • ASGR1
  • asialoglycoprotein receptor 1
  • CLEC4H1
  • C-type lectin domain family 4 member H1
  • Hepatic lectin H1
  • HL-1
  • MHL1
  • RHL1


ASGR1 encodes for a cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC-P
Species: Hu
Applications: WB, Flow, IHC-P
Species: Mu
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA

Publications for ASGPR1 Antibody (NBP1-54385) (0)

There are no publications for ASGPR1 Antibody (NBP1-54385).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASGPR1 Antibody (NBP1-54385) (0)

There are no reviews for ASGPR1 Antibody (NBP1-54385). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASGPR1 Antibody (NBP1-54385) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ASGPR1 Products

Bioinformatics Tool for ASGPR1 Antibody (NBP1-54385)

Discover related pathways, diseases and genes to ASGPR1 Antibody (NBP1-54385). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASGPR1 Antibody (NBP1-54385)

Discover more about diseases related to ASGPR1 Antibody (NBP1-54385).

Pathways for ASGPR1 Antibody (NBP1-54385)

View related products by pathway.

Blogs on ASGPR1

There are no specific blogs for ASGPR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ASGPR1 Antibody and receive a gift card or discount.


Gene Symbol ASGR1