Home » ASGPR1 » ASGPR1 Antibodies » ASGPR1 Antibody

ASGPR1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Jurkat Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Jurkat Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Liver, concentration 0.6ug/ml.
Western Blot: ASGPR1 Antibody [NBP1-54385] - Tissue: HepG2.
Western Blot: ASGPR1 Antibody [NBP1-54385] - Tissue: MCF7.
Western Blot: ASGPR1 Antibody [NBP1-54385] - Tissue: Human Fetal Heart.
Western Blot: ASGPR1 Antibody [NBP1-54385] - Tissue: Human Fetal Kidney.
Western Blot: ASGPR1 Antibody [NBP1-54385] - Tissue: 293T.
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Tissue: Human Stomach Tumor Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Human Fetal Kidney Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ASGPR1 Antibody Summary

Immunogen
Synthetic peptides corresponding to ASGR1 (asialoglycoprotein receptor 1) The peptide sequence was selected from the N terminal of ASGR1. Peptide sequence RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASGR1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against ASGR1 and was validated on Western blot.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ASGPR1 Antibody

  • ASGPR 1
  • ASGP-R 1
  • ASGPR
  • ASGPR1
  • ASGR1
  • asialoglycoprotein receptor 1
  • CLEC4H1
  • CLEC4H1ASGPR1
  • C-type lectin domain family 4 member H1
  • Hepatic lectin H1
  • HL-1
  • MHL1
  • RHL1

Background

ASGR1 encodes for a cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(19 Reviews)
(494 Publications)
Species: Hu
Angiotensin II/III
Antibody (Ang II E7 ( ...
NB100-62346
Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Evaluation of angiotensis II expression in untreated UUO rat kidneys and UUO rat kidneys treated with Ang-(1-7).
(9 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
(38 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Akt phosphorylated at S473 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(18 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Caspase-3 Antibody
(31A1067) - (Pro and ...
NB100-56708
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Analysis using the Azide Free version of NB100-56708. Detection of Caspase-3 activation in HeLa cells. Cells were treated with 2mM staurosporine for different time periods. Caspase-3 activation is determined by cleavage of procaspase-3.
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Western Blot Image of anti-Caspase 3 (31A1067). Whole cell protein from Jurkat cells treated with and without 2 uM staurosporine as indicated was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 5 ug/ml anti-Caspase 3 in 1% milk, and detected with an anti-mouse HRP secondary antibody using a Femto sensitivity chemiluminescence reagent. Note the detection of both pro-caspase 3 at 35 kDa and the cleaved active caspase 3 at 15-17 kDa.
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Analysis using the Azide Free version of NB100-56708. Detection of Caspase-3 in multiple human tissues. The tissues shown are A) brain, B) heart, C) intestine, D) kidney, E) liver, F) lung, G) muscle, H) stomach, I) spleen, J) ovary, and K) testis.
(1 Review)
(113 Publications)
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Asialoglycoprotein
Receptor 2 Antibody ( ...
NBP2-45505
Western Blot: Asialoglycoprotein Receptor 2 Antibody (2A12) [NBP2-45505] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Asialoglycoprotein receptor 2.
Immunohistochemistry: Asialoglycoprotein Receptor 2 Antibody (2A12) [NBP2-45505] - Analysis of Carcinoma of Human liver tissue.(Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Western Blot: Asialoglycoprotein Receptor 2 Antibody (2A12) [NBP2-45505] - Analysis of extracts (35ug) from 9 different cell lines (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human)
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Atrial Natriuretic
Peptide/ANP Antibody
NBP2-14873
Western Blot: Atrial Natriuretic Peptide/ANP Antibody [NBP2-14873] - Mouse tissue extracts (50 ug) was separated by 15 % SDS-PAGE, and the membrane was blotted with ANP antibody diluted by 1:5000.
Immunohistochemistry-Paraffin: Atrial Natriuretic Peptide/ANP Antibody [NBP2-14873] - Paraffin-embedded mouse muscle. ANP antibody [N1C3] ) diluted at 1:500.
Western Blot: Atrial Natriuretic Peptide/ANP Antibody [NBP2-14873] - Rat tissue extract (50 ug) was separated by 15% SDS-PAGE, and the membrane was blotted with ANP antibody [N1C3] diluted at 1:2000.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
DNAH6 Antibody
NBP1-84067
Immunohistochemistry-Paraffin: DNAH6 Antibody [NBP1-84067] - Staining of human placenta shows low expression as expected.
Immunohistochemistry-Paraffin: DNAH6 Antibody [NBP1-84067] - Staining of human fallopian tube shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: DNAH6 Antibody [NBP1-84067] - Staining of human fallopian tube shows high expression.
Species: Hu
Applications: IHC, IHC-P
Bcl-2 Antibody
NB100-56098
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 in whole cell lysate from Daoy cells. Cells were transfected with scrambled control siRNA (lane 1) or Bcl-2 siRNA (lane2). Image from verified customer review.
Western Blot: Bcl-2 Antibody [NB100-56098] - WB analysis of whole cell lysate (WCL) of Jurkat cells using anti-Bcl-2 antibody (NB100-56098) at 1:1000 dilution. HRP conjugated goat anti-rabbit IgG (H+L) cross adsorbed secondary antibody was used with ECL substrate for the detection of Bcl2 antibody bound to the blotted protein. This Bcl2 antibody detected a specific band at expected molecular weight marker position of Bcl2 protein (26kDa).
Immunohistochemistry-Paraffin: Bcl-2 Antibody [NB100-56098] - IHC analysis of a formalin-fixed paraffin-embedded (FFPE) human breast carcinoma tissue section using 1:1000 dilution of Bcl-2 antibody (NB100-56098) on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes. Bond Polymer Refine Detection (Leica Biosystems) and DAB were used for signal detection which followed counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) were performed using Aperio AT2 (Leica Biosystems). This antibody generated a diffused cytoplasmic staining of BCL2 in the cancer cells with relatively intense signal in their nuclear membranes. Staining was performed by Histowiz.
(2 Reviews)
(6 Publications)
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
GATA-4 Antibody
NBP2-24585
Western Blot: GATA-4 Antibody [NBP2-24585] - Analysis of GATA-4 in human kidney lysate in the 1) absence and 2) presence of immunizing peptide using this antibody. I goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: GATA-4 Antibody [NBP2-24585] - Formalin-fixed, paraffin-embedded human brain (cortex) probed with GATA-4 antibody at 10 ug/ml.
Immunohistochemistry-Paraffin: GATA-4 Antibody [NBP2-24585] - Formalin-fixed, paraffin-embedded human prostate probed with GATA-4 antibody at 10 ug/ml.
(1 Review)
Species: Hu
Applications: WB, IHC-P
NFkB p105/p50
Antibody (2J10D7)
NB100-56583
Western Blot: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - analysis of p50 in HeLa lysate in the A) absence and B) presence of immunizing peptide using p50 antibody at 5 ug/ml.
Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - analysis of human breast tumor tissue using an isotype control antibody (top) and p50 antibody (bottom) at 5 ug/ml.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on Jurkat cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, Flow, IHC-P
EphA3
640-A3
EphA3
(5 Publications)
Species: Mu
Transferrin
Antibody (HTF-14)
NB500-418
Western Blot: Transferrin Antibody (HTF-14) [NB500-418] - Analysis using the Azide Free version of NB500-418. Detection of 1. hTransferrin; 5 ug/well (red. con.) 2. hTransferrin; 3 ug/well (red. con.) 3. hTransferrin; 1 ug/well (red. con.) M. Low Range marker 4. hTransferrin; 1 ug/well (non-red. con.) 5. hTransferrin; 3 ug/well (non-red. con.) 6. hTransferrin; 5 ug/well (non-red. con.)
(1 Review)
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA

Publications for ASGPR1 Antibody (NBP1-54385) (0)

There are no publications for ASGPR1 Antibody (NBP1-54385).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASGPR1 Antibody (NBP1-54385) (0)

There are no reviews for ASGPR1 Antibody (NBP1-54385). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASGPR1 Antibody (NBP1-54385) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASGPR1 Products

Bioinformatics Tool for ASGPR1 Antibody (NBP1-54385)

Discover related pathways, diseases and genes to ASGPR1 Antibody (NBP1-54385). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASGPR1 Antibody (NBP1-54385)

Discover more about diseases related to ASGPR1 Antibody (NBP1-54385).
 

Pathways for ASGPR1 Antibody (NBP1-54385)

View related products by pathway.

Blogs on ASGPR1

There are no specific blogs for ASGPR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASGPR1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ASGR1
Entrez
Uniprot