Home » ASGPR1 » ASGPR1 Antibodies » ASGPR1 Antibody

ASGPR1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Jurkat Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Jurkat Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Liver, concentration 0.6ug/ml.
Western Blot: ASGPR1 Antibody [NBP1-54385] - Tissue: HepG2.
Western Blot: ASGPR1 Antibody [NBP1-54385] - Tissue: MCF7.
Western Blot: ASGPR1 Antibody [NBP1-54385] - Tissue: Human Fetal Heart.
Western Blot: ASGPR1 Antibody [NBP1-54385] - Tissue: Human Fetal Kidney.
Western Blot: ASGPR1 Antibody [NBP1-54385] - Tissue: 293T.
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Tissue: Human Stomach Tumor Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Human Fetal Kidney Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, GpSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ASGPR1 Antibody Summary

Immunogen
Synthetic peptides corresponding to ASGR1 (asialoglycoprotein receptor 1) The peptide sequence was selected from the N terminal of ASGR1. Peptide sequence RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (91%), Rat (92%), Porcine (93%), Guinea Pig (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASGR1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against ASGR1 and was validated on Western blot.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ASGPR1 Antibody

  • ASGPR 1
  • ASGP-R 1
  • ASGPR
  • ASGPR1
  • ASGR1
  • asialoglycoprotein receptor 1
  • CLEC4H1
  • CLEC4H1ASGPR1
  • C-type lectin domain family 4 member H1
  • Hepatic lectin H1
  • HL-1
  • MHL1
  • RHL1

Background

ASGR1 encodes for a cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(35 Reviews)
(649 Publications)
Species: Hu
Angiotensin II/III
Antibody (Ang II E7 ( ...
NB100-62346
Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Protein expressions of intrarenal RAS components in two groups of mice. Western blot analysis for protein expressions of intrarenal RAS components in the two groups of mice. Image collected and cropped by CiteAb from the following publication (lipidworld.biomedcentral.com/articles/10.1186/1476-511X-12-49), licensed under a CC-BY licence.
Immunohistochemistry: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Protein expressions of intrarenal RAS components in two groups of mice. (A) Immunohistochemical analysis of intrarenal RAS expression position in the two groups of mice. AGT immunoreactivity in the proximal tubular cells, Ang II immunoreactivity in both glomerular and tubular cells, renin immunoreactivity in juxtaglomerular apparatus cells, ACE immunoreactivity in brush border membranes of proximal tubules as well as AT1 and AT2 immunoreactivity in the proximal tubules were increased in the HF group when compared to the control group. Image collected and cropped by CiteAb from the following publication (lipidworld.biomedcentral.com/articles/10.1186/1476-511X-12-49), licensed under a CC-BY licence.
Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Evaluation of angiotensis II expression in untreated UUO rat kidneys and UUO rat kidneys treated with Ang-(1-7).
(14 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.
(39 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(23 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Caspase-3 Antibody
(31A1067) - (Pro and ...
NB100-56708
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Image of Caspase-3 Antibody (31A1067) - (Pro and Active). Whole cell protein from Jurkat cells treated with and without 2 uM staurosporine as indicated was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 5 ug/ml anti-Caspase 3 in 1% milk, and detected with an anti-mouse HRP secondary antibody using a Femto sensitivity chemiluminescence reagent. Note the detection of both pro-caspase 3 at 35 kDa and the cleaved active caspase 3 at 15-17 kDa.
Immunohistochemistry-Paraffin: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Tissue section of human spleen using 1:200 dilution of Caspase-3 antibody (clone 31A1067). The staining was developed with HRP labeled anti-mouse IgG secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This Caspase 3 antibody generated primarily a specific cytoplasmic staining in a subset of spleenocytes with some nuclear signal in a few cells.
Simple Western: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Simple Western lane view shows a specific band for Caspase-3 Antibody (31A1067) - (Pro and Active) in 0.1 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230kDa separation system.
(1 Review)
(153 Publications)
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
Angiogenin [HRP]
DAN00
(20 Publications)
Species: Hu
Asialoglycoprotein
Receptor 2 Antibody
NBP1-85578
Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85578] - Staining in human liver and pancreas tissues using anti-ASGR2 antibody. Corresponding ASGR2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85578] - Staining of human colon, liver, lymph node and pancreas using Anti-ASGR2 antibody NBP1-85578 (A) shows similar protein distribution across tissues to independent antibody NBP1-85579 (B).
Western Blot: Asialoglycoprotein Receptor 2 Antibody [NBP1-85578] - Analysis in human cell line HepG2.
(1 Review)
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
ERK2 Antibody
(191801) [Unconjugate
MAB1230
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, U937 human histiocytic lymphoma cell line,PC‑12 rat adrenal pheochromocytoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for ERK2 at approximately 44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ERK2 was detected in immersion fixed 3T3‑L1 mouse embryonic fibroblast adipose-like cell line using Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.5 mg/mL. A specific band was detected for ERK2 at approximately 43 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
IL-6 [HRP]
D6050
(26 Reviews)
(474 Publications)
Species: Hu
Atrial Natriuretic
Peptide/ANP Antibody
NBP2-14873
Western Blot: Atrial Natriuretic Peptide/ANP Antibody [NBP2-14873] - Knockdown of ATE1 attenuates cardiac hypertrophy. Western blot analysis of ANP protein levels in heart samples from sham and renal ligated rats (B2) bar graph was generated by quantifying the blots and normalizing the intensities of bands to the untreated lane (C) BNP and (D) beta-MHC in Ligated ATE1 siRNA when compared with Ligated NS siRNA samples. Statistical analysis was carried out by one-way ANOVA. Data are represented as mean +/- SE. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-019-57379-7) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Atrial Natriuretic Peptide/ANP Antibody [NBP2-14873] - Mouse heart. ANP stained by ANP antibody [N1C3] diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Western Blot: Atrial Natriuretic Peptide/ANP Antibody [NBP2-14873] - Rat tissue extract (50 ug) was separated by 15% SDS-PAGE, and the membrane was blotted with ANP antibody [N1C3] diluted at 1:2000.
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
DNAH6 Antibody
NBP1-84067
Immunohistochemistry-Paraffin: DNAH6 Antibody [NBP1-84067] - Staining of human placenta shows low expression as expected.
Immunohistochemistry-Paraffin: DNAH6 Antibody [NBP1-84067] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: DNAH6 Antibody [NBP1-84067] - Staining in human fallopian tube and placenta tissues using anti-DNAH6 antibody. Corresponding DNAH6 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
Bcl-2 Antibody
NB100-56098
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 in whole cell lysate from Daoy cells. Cells were transfected with (1) scrambled control siRNA or (2) Bcl-2 siRNA. Image from verified customer review.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of whole cell lysate (WCL) of Jurkat cells using anti-Bcl-2 antibody (NB100-56098) at 1:1000 dilution. HRP conjugated goat anti-rabbit IgG (H+L) cross adsorbed secondary antibody was used with ECL substrate for the detection of Bcl2 antibody bound to the blotted protein. This Bcl2 antibody detected a specific band at expected molecular weight marker position of Bcl2 protein (26kDa).
Immunohistochemistry-Paraffin: Bcl-2 Antibody [NB100-56098] - Analysis of a FFPE human breast carcinoma tissue section using 1:1000 dilution of Bcl-2 antibody (NB100-56098) on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes. Bond Polymer Refine Detection (Leica Biosystems) and DAB were used for signal detection which followed counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) were performed using Aperio AT2 (Leica Biosystems). This antibody generated a diffused cytoplasmic staining of BCL2 in the cancer cells with relatively intense signal in their nuclear membranes. Staining was performed by Histowiz.
(2 Reviews)
(11 Publications)
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
GATA-4 Antibody
NBP2-24585
Western Blot: GATA-4 Antibody [NBP2-24585] - Analysis of GATA-4 in human kidney lysate in the 1) absence and 2) presence of immunizing peptide using this antibody. I goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: GATA-4 Antibody [NBP2-24585] - Staining in human pancreatic tissue stained for GATA4 (green), nuclear localization.
Immunohistochemistry-Paraffin: GATA-4 Antibody [NBP2-24585] - Formalin-fixed, paraffin-embedded human prostate probed with GATA-4 antibody at 10 ug/ml.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NFkB p105/p50
Antibody (2J10D7)
NB100-56583
Western Blot: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - Analysis of p50 in HeLa lysate in the A) absence and B) presence of immunizing peptide using p50 antibody at 5 ug/ml.
Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - IHC-P of rabbit aorta using NB100-56583. Secondary antibody: anti-mouse histofine ( Nisherei Bioscience Inc. ref: 414131F). Development: DAB (Dako ref: K346811-2) and counterstained with Hematoxylin. Submitted via verified customer review
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on U937 cells with NFkB p105/p50 [2J10D7] Antibody NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.
(1 Review)
(4 Publications)
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
EphA3
640-A3
EphA3
(5 Publications)
Species: Mu
Holo-Transferrin
2914-HT
Holo-Transferrin
(2 Reviews)
(18 Publications)
Species: Hu
ASGPR1 Antibody
NBP1-54385
ASGPR1 Antibody
Species: Hu, Mu, Rt, Po, Gp
Applications: WB, IHC

Publications for ASGPR1 Antibody (NBP1-54385) (0)

There are no publications for ASGPR1 Antibody (NBP1-54385).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASGPR1 Antibody (NBP1-54385) (0)

There are no reviews for ASGPR1 Antibody (NBP1-54385). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASGPR1 Antibody (NBP1-54385) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ASGPR1 Products

Bioinformatics Tool for ASGPR1 Antibody (NBP1-54385)

Discover related pathways, diseases and genes to ASGPR1 Antibody (NBP1-54385). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASGPR1 Antibody (NBP1-54385)

Discover more about diseases related to ASGPR1 Antibody (NBP1-54385).
 

Pathways for ASGPR1 Antibody (NBP1-54385)

View related products by pathway.

Blogs on ASGPR1

There are no specific blogs for ASGPR1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASGPR1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ASGR1
Uniprot