ASCL1/Mash1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ASCL1/Mash1 Antibody [NBP3-17687] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ASCL1/Mash1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSL
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ASCL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ASCL1/Mash1 Antibody - BSA Free

• achaete-scute complex (Drosophila) homolog-like 1
• achaete-scute complex homolog 1 (Drosophila)
• achaete-scute complex-like 1 (Drosophila)
• achaete-scute homolog 1
• ASCL1
• ASH1
• ASH-1
• ASH1MASH1
• BHLHA46
• bHLHa46achaete-scute complex-like 1
• Class A basic helix-loop-helix protein 46
• HASH1
• HASH1achaete scute protein
• Mash1

Background

MASH1 encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ASCL1