Home » ASAP1 » ASAP1 Antibodies » ASAP1 Antibody

ASAP1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: ASAP1 Antibody [NBP2-48519] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ASAP1 Antibody [NBP2-48519] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ASAP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: STPRDKQRLSYGAFTNQIFVSTSTDSPTSPTTEAPPLPPRNAGKGNDGGPSSSSKTTNKFEGLSQQSSTSSAKTALGPRVLPKLPQKVALRKT
Predicted Species
Mouse (92%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ASAP1 Recombinant Protein Antigen (NBP2-48519PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ASAP1 Antibody

  • 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activatingprotein
  • AMAP1
  • ARF GTPase-activating protein 1
  • arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1
  • ArfGAP with SH3 domain, ankyrin repeat and PH domain 1
  • centaurin, beta 4
  • CENTB4
  • DDEF1ADP-ribosylation factor-directed GTPase-activating protein 1
  • development and differentiation enhancing factor 1
  • Development and differentiation-enhancing factor 1
  • Differentiation-enhancing factor 1
  • KIAA1249DEF-1
  • PAG2
  • PAP
  • PIP2-dependent ARF1 GAP
  • ZG14P

Background

ASAP1 (also known as AMAP1, 130-kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein, PIP2-dependent ARF1 GAP,ADP-ribosylation factor-directed GTPase-activating protein 1, ARF GTPase-activating protein 1, Development and differentiation-enhancing factor 1, Differentiation-enhancing factor 1, DEF-1) is an Arf-directed GTPase activating protein that is a substrate for the kinases Src and FAK and has been implicated in the regulation of membrane traffic, focal adhesions and invadopodia/podosomes. Phosphorylation of ASAP1 at tyrosine 782 has been found to affect enzymatic and some biological activities, including the function of invadopodia. ASAP1 is expressed in many tissues but is most abundant in the testis, brain, lung and spleen. A heightened expression was seen in the adipose tissue from obese (ob) and diabetic (db) animals. Multiple transcript variants have been reported for this protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Kallikrein 3/PSA
[HRP]
DKK300
(16 Publications)
Species: Hu
Applications: ELISA
Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western blot shows lysates of LNCaP human prostate cancer cell line. PVDF Membrane was probed with 1 µg/mL of Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Prostatic Acid Phosphatase/ACPP at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Prostatic Acid Phosphatase/ACPP was detected in immersion fixed paraffin-embedded sections of human prostate using Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hemotoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human Prostatic Acid Phosphatase/ACPP protein was serially diluted 2-fold and captured by Mouse Anti-Human Prostatic Acid Phosphatase/ACPP Monoclonal Antibody (Catalog # MAB62401) coated on a Clear Polystyrene Microplate (Catalog # DY990). Sheep Anti-Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
(1 Publication)
Species: Hu
Applications: ELISA, IHC, WB

Puromycin-sensitive am ...
NBP2-13669
Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human Fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PSAT1 Antibody
NBP1-32920
Western Blot: PSAT1 Antibody [NBP1-32920] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with PSAT1 antibody [N1C3] diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: PSAT1 Antibody [NBP1-32920] - Paraformaldehyde-fixed A549, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: PSAT1 Antibody [NBP1-32920] - NCI-N87 xenograft, using PSAT1antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(5 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Protein S/PROS1
Antibody [Unconjugate
AF4036
Western blot shows human plasma. PVDF membrane was probed with 0.2 µg/mL of Goat Anti-Human Protein S/PROS1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4036) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). Specific bands were detected for Protein S/PROS1 at approximately 80 & 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows human plasma, loaded at 0.2 mg/mL. A specific band was detected for Protein S/PROS1 at approximately 106 kDa (as indicated) using 2 µg/mL of Goat Anti-Human Protein S/PROS1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4036) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(3 Publications)
Species: Hu
Applications: Simple Western, WB
PLAG1 Antibody
(3B7)
H00005324-M02
Immunohistochemistry: PLAG1 Antibody (3B7) [H00005324-M02] - Left, IHC showing TGFBR3 staining in whole tumor sections (upper panels, scale bars=5mm) and enlargement of selected areas (lower panels, scale bars=100um). Right, quantification of IHC TGFBR3 levels in TGFBR3-PLAG1 positive vs. negative tumors. P (high TGFBR3)=0.002, Fisher's exact test. n=5+34. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41467-017-01178-z), licensed under a CC-BY licence.
ELISA: PLAG1 Antibody (3B7) [H00005324-M02] - Detection limit for recombinant GST tagged PLAG1 is approximately 0.03ng/ml as a capture antibody.
Western Blot: PLAG1 Antibody (3B7) [H00005324-M02] - Western Blot detection against Immunogen (36.52 KDa) .
(11 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
PDXP Antibody
NBP2-93574
Western Blot: PDXP Antibody [NBP2-93574] - Analysis of extracts of various cell lines, using PDXP at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 10s.
Immunocytochemistry/Immunofluorescence: PDXP Antibody [NBP2-93574] - Immunofluorescence analysis of L929 cells using PDXP Rabbit pAb (NBP2-93574) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: PDXP Antibody [NBP2-93574] - Immunohistochemistry of paraffin-embedded Mouse kidney using PDXP Rabbit pAb (NBP2-93574) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CD155/PVR Antibody
(300907) [Unconjugate ...
MAB25301
U937 human histiocytic lymphoma cell line was stained with Mouse Anti-Human CD155/PVR Monoclonal Antibody (Catalog # MAB25301, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). View our protocol for Staining Membrane-associated Proteins.
HUVEC human umbilical vein endothelial cells were stained with Mouse Anti-Human CD155/PVR Monoclonal Antibody (Catalog # MAB25301, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). View our protocol for Staining Membrane-associated Proteins.
CD155/PVR was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using Mouse Anti-Human CD155/PVR Monoclonal Antibody (Catalog # MAB25301) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(1 Review)
(7 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-PMEL17/SILV mouse monoclonal antibody.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded breast tissue using anti-PMEL17/SILV mouse monoclonal antibody.
(1 Review)
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NDUFB6 Antibody
NBP1-92172
Immunohistochemistry-Paraffin: NDUFB6 Antibody [NBP1-92172] - Staining of human prostate shows strong cytoplasmic positivity with granular pattern in glandular cells.
Western Blot: NDUFB6 Antibody [NBP1-92172] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: NDUFB6 Antibody [NBP1-92172] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-Page: Recombinant Human PRH2 Protein [H00005555-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(46 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Coagulation Factor
II/Thrombin Antibody
NBP1-58268
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue, 5.0ug/ml.
Western Blot: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - 721_B tissue lysate at a concentration of 1ug/ml.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
ATAT1 Antibody
NBP2-48990
Immunocytochemistry/Immunofluorescence: ATAT1 Antibody [NBP2-48990] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATAT1 Antibody [NBP2-48990] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: ATAT1 Antibody [NBP2-48990] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TAT Antibody
NBP1-79286
Western Blot: TAT Antibody [NBP1-79286] - Rat Brain Lysate 1.0 ug/ml, gel concentration 12%
(1 Review)
Species: Rt
Applications: WB
PAPD1 Antibody
(1D3)
NBP2-43686
Immunocytochemistry/Immunofluorescence: PAPD1 Antibody (1D3) [NBP2-43686] - Analysis of methanol-fixed HeLa, using mtPAP antibody at 1:100 dilution.
Immunohistochemistry-Paraffin: PAPD1 Antibody (1D3) [NBP2-43686] - Analysis of Hepatoma, using mtPAP antibody at 1:200 dilution.
Western Blot: PAPD1 Antibody (1D3) [NBP2-43686] - Analysis of 30 ug whole cell lysate. A: A549 B: H1299 C: HCT116 D: MCF-7 7.5% SDS PAGE diluted at 1:1000.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Serpin E1/PAI-1
[HRP]
DSE100
(40 Publications)
Species: Hu
Applications: ELISA
CEACAM5/CD66e
Antibody (CEA31) - Az ...
NBP2-34594
Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free [NBP2-34594] - Human Colon Carcinoma stained with CEACAM5/CD66e Antibody (CEA31).
Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free [NBP2-34594] - Human Colon Carcinoma stained with CEACAM5/CD66e Antibody (CEA31).
Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free [NBP2-34594] - Human Colon Carcinoma stained with CEACAM5/CD66e Antibody (CEA31).
(2 Reviews)
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
CEACAM7 Antibody
[Unconjugated]
AF4478
CEACAM‑7 was detected in immersion fixed paraffin-embedded sections of human colon cancer tissue using Sheep Anti-Human CEACAM‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4478) at 3 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to cell surfaces of cancer cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of LNCaP human prostate cancer cell line, HeLa human cervical epithelial carcinoma cell line and human liver tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human CEACAM‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4478) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for CEACAM‑7 at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu
Applications: IHC, WB
Recombinant Human
PSG2 GST (N-Term) Pro ...
H00005670-Q01
SDS-Page: Recombinant Human PSG2 Protein [H00005670-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB

Publications for ASAP1 Antibody (NBP2-48519) (0)

There are no publications for ASAP1 Antibody (NBP2-48519).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASAP1 Antibody (NBP2-48519) (0)

There are no reviews for ASAP1 Antibody (NBP2-48519). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ASAP1 Antibody (NBP2-48519) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASAP1 Products

Bioinformatics Tool for ASAP1 Antibody (NBP2-48519)

Discover related pathways, diseases and genes to ASAP1 Antibody (NBP2-48519). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASAP1 Antibody (NBP2-48519)

Discover more about diseases related to ASAP1 Antibody (NBP2-48519).
 

Pathways for ASAP1 Antibody (NBP2-48519)

View related products by pathway.

PTMs for ASAP1 Antibody (NBP2-48519)

Learn more about PTMs related to ASAP1 Antibody (NBP2-48519).
 

Research Areas for ASAP1 Antibody (NBP2-48519)

Find related products by research area.

Blogs on ASAP1

There are no specific blogs for ASAP1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASAP1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ASAP1