ASAP1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: STPRDKQRLSYGAFTNQIFVSTSTDSPTSPTTEAPPLPPRNAGKGNDGGPSSSSKTTNKFEGLSQQSSTSSAKTALGPRVLPKLPQKVALRKT |
| Predicted Species |
Mouse (92%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ASAP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for ASAP1 Antibody - BSA Free
Background
ASAP1 (also known as AMAP1, 130-kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein, PIP2-dependent ARF1 GAP,ADP-ribosylation factor-directed GTPase-activating protein 1, ARF GTPase-activating protein 1, Development and differentiation-enhancing factor 1, Differentiation-enhancing factor 1, DEF-1) is an Arf-directed GTPase activating protein that is a substrate for the kinases Src and FAK and has been implicated in the regulation of membrane traffic, focal adhesions and invadopodia/podosomes. Phosphorylation of ASAP1 at tyrosine 782 has been found to affect enzymatic and some biological activities, including the function of invadopodia. ASAP1 is expressed in many tissues but is most abundant in the testis, brain, lung and spleen. A heightened expression was seen in the adipose tissue from obese (ob) and diabetic (db) animals. Multiple transcript variants have been reported for this protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC
Publications for ASAP1 Antibody (NBP2-48519) (0)
There are no publications for ASAP1 Antibody (NBP2-48519).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ASAP1 Antibody (NBP2-48519) (0)
There are no reviews for ASAP1 Antibody (NBP2-48519).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for ASAP1 Antibody (NBP2-48519) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ASAP1 Products
Research Areas for ASAP1 Antibody (NBP2-48519)
Find related products by research area.
|
Blogs on ASAP1