ASAP1 Antibody

Images

 
Immunohistochemistry-Paraffin: ASAP1 Antibody [NBP2-48519] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ASAP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: STPRDKQRLSYGAFTNQIFVSTSTDSPTSPTTEAPPLPPRNAGKGNDGGPSSSSKTTNKFEGLSQQSSTSSAKTALGPRVLPKLPQKVALRKT
Predicted Species
Mouse (92%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ASAP1 Recombinant Protein Antigen (NBP2-48519PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ASAP1 Antibody

  • 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activatingprotein
  • AMAP1
  • ARF GTPase-activating protein 1
  • arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1
  • ArfGAP with SH3 domain, ankyrin repeat and PH domain 1
  • centaurin, beta 4
  • CENTB4
  • DDEF1ADP-ribosylation factor-directed GTPase-activating protein 1
  • development and differentiation enhancing factor 1
  • Development and differentiation-enhancing factor 1
  • Differentiation-enhancing factor 1
  • KIAA1249DEF-1
  • PAG2
  • PAP
  • PIP2-dependent ARF1 GAP
  • ZG14P

Background

ASAP1 (also known as AMAP1, 130-kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein, PIP2-dependent ARF1 GAP,ADP-ribosylation factor-directed GTPase-activating protein 1, ARF GTPase-activating protein 1, Development and differentiation-enhancing factor 1, Differentiation-enhancing factor 1, DEF-1) is an Arf-directed GTPase activating protein that is a substrate for the kinases Src and FAK and has been implicated in the regulation of membrane traffic, focal adhesions and invadopodia/podosomes. Phosphorylation of ASAP1 at tyrosine 782 has been found to affect enzymatic and some biological activities, including the function of invadopodia. ASAP1 is expressed in many tissues but is most abundant in the testis, brain, lung and spleen. A heightened expression was seen in the adipose tissue from obese (ob) and diabetic (db) animals. Multiple transcript variants have been reported for this protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DKK300
Species: Hu
Applications: ELISA
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
NBP2-93574
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB25301
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-79286
Species: Rt
Applications: WB
NBP2-43686
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DSE100
Species: Hu
Applications: ELISA
NBP2-34594
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
AF4478
Species: Hu
Applications: IHC, WB
H00005670-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB

Publications for ASAP1 Antibody (NBP2-48519) (0)

There are no publications for ASAP1 Antibody (NBP2-48519).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASAP1 Antibody (NBP2-48519) (0)

There are no reviews for ASAP1 Antibody (NBP2-48519). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ASAP1 Antibody (NBP2-48519) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASAP1 Products

Bioinformatics Tool for ASAP1 Antibody (NBP2-48519)

Discover related pathways, diseases and genes to ASAP1 Antibody (NBP2-48519). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASAP1 Antibody (NBP2-48519)

Discover more about diseases related to ASAP1 Antibody (NBP2-48519).
 

Pathways for ASAP1 Antibody (NBP2-48519)

View related products by pathway.

PTMs for ASAP1 Antibody (NBP2-48519)

Learn more about PTMs related to ASAP1 Antibody (NBP2-48519).
 

Research Areas for ASAP1 Antibody (NBP2-48519)

Find related products by research area.

Blogs on ASAP1

There are no specific blogs for ASAP1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASAP1