Arylsulfatase G/ARSG Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Arylsulfatase G/ARSG Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARSG.
  
  

  Source: E. coli

  Amino Acid Sequence: YVTGIIGKWHLGHHGSYHPNFRGFDYYFGIPYSHDMGCTDTPGYNHPPCPACPQGDGPSRNLQRDCYTDVALPLYENLNIVEQPV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ARSG
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82948.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Arylsulfatase G/ARSG Recombinant Protein Antigen

• ARSG
• Arylsulfatase G
• ASG
• EC 3.1.6
• EC 3.1.6.-
• EC 3.1.6.4
• KIAA1001ASG

Background

Sulfatases, such as ARSG, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules. This gene, a novel arylsulfatase, has activity toward pseudosubstrates including p-nitrocatechol sulfate and 4-methylumbelliferyl sulfate. Activity is competitively inhibited by phosphate. The unprocessed protein is active as a 63-kDa monomer and demonstrates an acidic pH optimum as typically seen for lysosomal sulfatases. The protein accumulates within lysosomes and is also a glycoprotein that binds specifically to mannose 6-phosphate receptors. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ARSG