Arylsulfatase B/ARSB Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Arylsulfatase B/ARSB Antibody [NBP1-86270] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.

Staining of human liver shows strong cytoplasmic granular positivity in cytoplasm in hepatocytes.

Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Arylsulfatase B/ARSB Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Arylsulfatase B/ARSB Antibody - BSA Free (NBP1-86270) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARSB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Arylsulfatase B/ARSB Protein (NBP1-86270PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Arylsulfatase B/ARSB Antibody - BSA Free

• ARSB
• Arylsulfatase B
• ASB
• EC 3.1.6.12
• G4S
• MPS6
• N-acetylgalactosamine-4-sulfatase

Background

Arylsulfatase B encoded by this gene belongs to the sulfatase family. The arylsulfatase B homodimer hydrolyzes sulfate groups of N-Acetyl-D-galactosamine, chondriotin sulfate, and dermatan sulfate. The protein is targetted to the lysozyme. Mucopolysaccharidosis type VI is an autosomal recessive lysosomal storage disorder resulting from a deficiency of arylsulfatase B. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARSB