Arylsulfatase B/ARSB Antibody

Images

 
Immunohistochemistry: Arylsulfatase B/ARSB Antibody [NBP1-86270] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Arylsulfatase B/ARSB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARSB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Arylsulfatase B/ARSB Protein (NBP1-86270PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Arylsulfatase B/ARSB Antibody

  • ARSB
  • Arylsulfatase B
  • ASB
  • EC 3.1.6.12
  • G4S
  • MPS6
  • N-acetylgalactosamine-4-sulfatase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2485
Species: Hu
Applications: WB, IHC, IP
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
H00000439-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
AF5787
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
H00347527-B01P
Species: Hu
Applications: WB, ELISA
NBP1-86270
Species: Hu
Applications: IHC, IHC-P

Publications for Arylsulfatase B/ARSB Antibody (NBP1-86270) (0)

There are no publications for Arylsulfatase B/ARSB Antibody (NBP1-86270).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Arylsulfatase B/ARSB Antibody (NBP1-86270) (0)

There are no reviews for Arylsulfatase B/ARSB Antibody (NBP1-86270). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Arylsulfatase B/ARSB Antibody (NBP1-86270) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Arylsulfatase B/ARSB Products

Bioinformatics Tool for Arylsulfatase B/ARSB Antibody (NBP1-86270)

Discover related pathways, diseases and genes to Arylsulfatase B/ARSB Antibody (NBP1-86270). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Arylsulfatase B/ARSB Antibody (NBP1-86270)

Discover more about diseases related to Arylsulfatase B/ARSB Antibody (NBP1-86270).
 

Pathways for Arylsulfatase B/ARSB Antibody (NBP1-86270)

View related products by pathway.

PTMs for Arylsulfatase B/ARSB Antibody (NBP1-86270)

Learn more about PTMs related to Arylsulfatase B/ARSB Antibody (NBP1-86270).

Blogs on Arylsulfatase B/ARSB

There are no specific blogs for Arylsulfatase B/ARSB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Arylsulfatase B/ARSB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARSB
Entrez