Aromatase Recombinant Protein Antigen

Images

 
There are currently no images for Aromatase Recombinant Protein Antigen (NBP2-48998PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Aromatase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Aromatase.

Source: E. coli

Amino Acid Sequence: IGERDIKIDDIQKLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CYP19A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48998.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Aromatase Recombinant Protein Antigen

  • ARO1
  • ARO1EC 1.14.14.1
  • Aromatase
  • AROsubfamily XIX (aromatization of androgens)
  • CYAR
  • CYARMGC104309
  • CYP19
  • CYP19A1
  • CYPXIX
  • cytochrome P450, family 19, subfamily A, polypeptide 1
  • Cytochrome P-450AROM
  • EC 1.14.14.14
  • Estrogen synthase
  • microsomal monooxygenase

Background

Aromatase is a member of the cytochrome P450 superfamily, whose function is to produce estrogens by aromatizing androgens. The primary function of Aromatase is to convert androstenedione to estrone and testosterone to estradiol. This protein is also a key enzyme in steroidogenesis, specifically for the biosynthesis of estrogens. Because estrogens also promote certain cancers and other diseases, aromatase inhibitors are frequently used to treat such diseases. It also plays an important role in sexual differentiation, fertility, and carcinogenesis.

Aromatase is localized in the endoplasmic reticulum of the cell and its activity is regulated by tissue specific promoters that are in turn controlled by hormones, cytokines, and other factors. It can be found in many tissues reproductive tissues including gonads, brain, adipose tissue, placenta, blood vessels, skin, bone, endometrium as well as in tissue of endometriosis, uterine fibroids, breast cancer, and endometrial cancer.

Many environmental chemicals may influence aromatase activity and thereby disrupt endocrine function. The activity is increased by environmental factors such as age, obesity, insulin, gonadotropins, and alcohol but decreased by prolactin, anti-m llerian hormone, and smoking.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-84310
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38770
Species: Hu, Mu
Applications:  IHC-P, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-01151
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
NB200-305
Species: Hu, Pm, Mu
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
291-G1
Species: Hu
Applications: BA
1129-ER
Species: Hu
Applications: BA
NBP1-54758
Species: Hu
Applications: IHC,  IHC-P, WB
262-AR
Species: Hu
Applications: BA
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-36489
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for Aromatase Recombinant Protein Antigen (NBP2-48998PEP) (0)

There are no publications for Aromatase Recombinant Protein Antigen (NBP2-48998PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aromatase Recombinant Protein Antigen (NBP2-48998PEP) (0)

There are no reviews for Aromatase Recombinant Protein Antigen (NBP2-48998PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Aromatase Recombinant Protein Antigen (NBP2-48998PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Aromatase Products

Research Areas for Aromatase Recombinant Protein Antigen (NBP2-48998PEP)

Find related products by research area.

Blogs on Aromatase.

Aromatase - A Key Enzyme in the Biosynthesis of Estrogens
The enzyme, aromatase, belongs to cytochrome P450 family of monooxygenases known for their key role in drug catabolism and cholesterol/steroid synthesis. Aromatase uses a heme-group as a co-factor to catalyze the formation of aromatic C18 estrogens fr...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Aromatase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP19A1