Aromatase Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Aromatase Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Aromatase.
  
  

  Source: E. coli

  Amino Acid Sequence: IGERDIKIDDIQKLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CYP19A1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48998.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Aromatase Recombinant Protein Antigen

• ARO1
• ARO1EC 1.14.14.1
• Aromatase
• AROsubfamily XIX (aromatization of androgens)
• CYAR
• CYARMGC104309
• CYP19
• CYP19A1
• CYPXIX
• cytochrome P450, family 19, subfamily A, polypeptide 1
• Cytochrome P-450AROM
• EC 1.14.14.14
• Estrogen synthase
• microsomal monooxygenase

Background

Aromatase is a member of the cytochrome P450 superfamily, whose function is to produce estrogens by aromatizing androgens. The primary function of Aromatase is to convert androstenedione to estrone and testosterone to estradiol. This protein is also a key enzyme in steroidogenesis, specifically for the biosynthesis of estrogens. Because estrogens also promote certain cancers and other diseases, aromatase inhibitors are frequently used to treat such diseases. It also plays an important role in sexual differentiation, fertility, and carcinogenesis.

Aromatase is localized in the endoplasmic reticulum of the cell and its activity is regulated by tissue specific promoters that are in turn controlled by hormones, cytokines, and other factors. It can be found in many tissues reproductive tissues including gonads, brain, adipose tissue, placenta, blood vessels, skin, bone, endometrium as well as in tissue of endometriosis, uterine fibroids, breast cancer, and endometrial cancer.

Many environmental chemicals may influence aromatase activity and thereby disrupt endocrine function. The activity is increased by environmental factors such as age, obesity, insulin, gonadotropins, and alcohol but decreased by prolactin, anti-m llerian hormone, and smoking.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CYP19A1