ARL15 Antibody

Images

 
Western Blot: ARL15 Antibody [NBP2-56877] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: ARL15 Antibody [NBP2-56877] - Staining of human cell line RT4 shows localization to plasma membrane, the Golgi apparatus & cell junctions.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARL15 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARL15
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARL15 Recombinant Protein Antigen (NBP2-56877PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ARL15 Antibody

  • ADP-ribosylation factor related protein 2
  • ADP-ribosylation factor-like 15
  • ADP-ribosylation factor-like protein 15
  • ADP-ribosylation factor-related protein 2
  • ARF-related protein 2
  • ARFRP2
  • FLJ20051

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DRP300
Species: Hu
Applications: ELISA
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00001032-M08
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
MAB19081
Species: Hu
Applications: CyTOF-ready, Flow
NBP1-89993
Species: Hu
Applications: IHC, IHC-P, WB
AF3264
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
DM1300
Species: Hu
Applications: ELISA
368-ST/CF
Species: Hu
Applications: BA
NB600-582
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
NBP2-67187
Species: Hu, Mu, Rt, Ze
Applications: IHC, IHC-P, IP, WB
NBP2-14950
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-13215
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-77687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF5647
Species: Hu, Mu
Applications: ICC, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
H00131368-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-20089
Species: Hu
Applications: ICC/IF, KD, WB
NBP1-86002
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-28632
Species: Hu, Mu
Applications: ICC/IF, Simple Western, WB

Publications for ARL15 Antibody (NBP2-56877) (0)

There are no publications for ARL15 Antibody (NBP2-56877).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL15 Antibody (NBP2-56877) (0)

There are no reviews for ARL15 Antibody (NBP2-56877). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARL15 Antibody (NBP2-56877) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARL15 Products

Bioinformatics Tool for ARL15 Antibody (NBP2-56877)

Discover related pathways, diseases and genes to ARL15 Antibody (NBP2-56877). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARL15 Antibody (NBP2-56877)

Discover more about diseases related to ARL15 Antibody (NBP2-56877).
 

Pathways for ARL15 Antibody (NBP2-56877)

View related products by pathway.

PTMs for ARL15 Antibody (NBP2-56877)

Learn more about PTMs related to ARL15 Antibody (NBP2-56877).

Blogs on ARL15

There are no specific blogs for ARL15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARL15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL15