ARID5A Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ARID5A Antibody [NBP1-81037] - Staining of human cell line A-431 shows positivity in nucleus and nucleoli.

Analysis in human cell line HDLM-2.

ChIP-Exo-Seq composite graph for Anti-ARID5A (NBP1-81037) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Staining of human urinary bladder shows strong nuclear positivity in urothelial cells.

Staining of human prostate shows moderate nuclear positivity in glandular cells.

Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARID5A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ARID5A Antibody - BSA Free (NBP1-81037) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LVLPYVRHLKGEDDKPLPTSKPRKQYKMAKENRGDDGATERPKKAKEERRMDQMMPGKTKADAADPAPLPSQEPPRNSTEQQGLASGSSVSFVGASGCPEAYKRLLSSFYCKGTH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARID5A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ARID5A Protein (NBP1-81037PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ARID5A Antibody - BSA Free

• ARID domain-containing protein 5A
• AT rich interactive domain 5A (MRF1-like)
• AT-rich interactive domain-containing protein 5A
• RFVG5814

Background

Members of the ARID protein family, including ARID5A, have diverse functions but all appear to play important roles indevelopment, tissue-specific gene expression, and regulation of cell growth (Patsialou et al., 2005 (PubMed15640446)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARID5A
• Entrez:
  • 10865(Human)
• Uniprot:
  • Q03989(Human)