ARID1B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ARID1B Antibody [NBP1-89358] - Staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ARID1B Antibody [NBP1-89358] - Staining of human urinary bladder shows strong nuclear positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARID1B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SQYGPQGNYSRPPAYSGVPSASYSGPGPGMGISANNQMHGQGPSQPCGAVPLGRMPSAGMQNRPFPGNMSSMTPSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAVMQAAANSAQSR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARID1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARID1B Protein (NBP1-89358PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARID1B Antibody

  • 6A3-5
  • ARID domain-containing protein 1B
  • AT rich interactive domain 1B (SWI1-like)
  • BAF250B
  • BRG1-associated factor 250b
  • BRG1-binding protein ELD/OSA1
  • BRG1-binding protein hELD/OSA1
  • BRIGHT
  • DAN15P250R
  • ELD (eyelid)/OSA protein
  • ELD/OSA1
  • hOsa2
  • JPUT1
  • KDM5B
  • KIAA1235AT-rich interactive domain-containing protein 1B
  • Osa homolog 2
  • OSA2
  • p250R
  • PLU1
  • RBBP2H1A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88932
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB766
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00008815-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-79833
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-43567
Species: Hu, Mu
Applications: WB
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87544
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-20415
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-30941
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2242
Species: Hu, Mu
Applications: WB, ChIP, IP
H00006760-B01P
Species: Hu
Applications: WB, ICC/IF
1705-HH/CF
Species: Hu, Mu
NBP1-28727
Species: Hu
Applications: IP (-), WB, IHC-P

Publications for ARID1B Antibody (NBP1-89358) (0)

There are no publications for ARID1B Antibody (NBP1-89358).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARID1B Antibody (NBP1-89358) (0)

There are no reviews for ARID1B Antibody (NBP1-89358). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ARID1B Antibody (NBP1-89358) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARID1B Products

Bioinformatics Tool for ARID1B Antibody (NBP1-89358)

Discover related pathways, diseases and genes to ARID1B Antibody (NBP1-89358). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARID1B Antibody (NBP1-89358)

Discover more about diseases related to ARID1B Antibody (NBP1-89358).
 

Pathways for ARID1B Antibody (NBP1-89358)

View related products by pathway.

PTMs for ARID1B Antibody (NBP1-89358)

Learn more about PTMs related to ARID1B Antibody (NBP1-89358).

Blogs on ARID1B

There are no specific blogs for ARID1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARID1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARID1B