ARHGEF5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ARHGEF5 Antibody [NBP1-83371] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.
Immunohistochemistry-Paraffin: ARHGEF5 Antibody [NBP1-83371] - Staining of human hippocampus shows strong nuclear and cytoplasmic positivity in neurons.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGEF5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PAREPLRRTTPQQGASGPGRSPVGQARQPEKPSHLHLEKASSWPHRRDSGRPPGDSSGQAVAPSEGANKHKGWS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGEF5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARHGEF5 Protein (NBP1-83371PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARHGEF5 Antibody

  • ephexin-3
  • GEF5
  • Guanine nucleotide regulatory protein TIM
  • Oncogene TIM
  • p60 TIM
  • P60
  • Rho guanine nucleotide exchange factor (GEF) 5
  • rho guanine nucleotide exchange factor 5
  • TIM1
  • TIMDKFZp686N1969
  • Transforming immortalized mammary oncogene

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-40853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NBP1-76701
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2365
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF771
Species: Mu
Applications: WB, IHC, Neut
NBP1-81404
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-15939
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-83371
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ARHGEF5 Antibody (NBP1-83371) (0)

There are no publications for ARHGEF5 Antibody (NBP1-83371).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGEF5 Antibody (NBP1-83371) (0)

There are no reviews for ARHGEF5 Antibody (NBP1-83371). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ARHGEF5 Antibody (NBP1-83371) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARHGEF5 Products

Bioinformatics Tool for ARHGEF5 Antibody (NBP1-83371)

Discover related pathways, diseases and genes to ARHGEF5 Antibody (NBP1-83371). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGEF5 Antibody (NBP1-83371)

Discover more about diseases related to ARHGEF5 Antibody (NBP1-83371).
 

Pathways for ARHGEF5 Antibody (NBP1-83371)

View related products by pathway.

PTMs for ARHGEF5 Antibody (NBP1-83371)

Learn more about PTMs related to ARHGEF5 Antibody (NBP1-83371).
 

Research Areas for ARHGEF5 Antibody (NBP1-83371)

Find related products by research area.

Blogs on ARHGEF5

There are no specific blogs for ARHGEF5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGEF5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGEF5