ARHGAP4 Antibody - BSA Free

Immunohistochemistry: ARHGAP4 Antibody [NBP3-35825] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using ARHGAP4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: ARHGAP4 Antibody [NBP3-35825] - Immunohistochemistry analysis of paraffin-embedded Mouse heart using ARHGAP4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: ARHGAP4 Antibody [NBP3-35825] - Immunohistochemistry analysis of paraffin-embedded Rat heart using ARHGAP4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: ARHGAP4 Antibody [NBP3-35825] - Immunofluorescence analysis of L929 cells using ARHGAP4 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: ARHGAP4 Antibody [NBP3-35825] - Western blot analysis of lysates from Jurkat cells, using ARHGAP4 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARHGAP4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ARHGAP4 Antibody - BSA Free (NBP3-35825) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 900 to the C-terminus of human ARHGAP4 (NP_001158213.1).
  
  Sequence:
  SPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASTTSPSPGPRSPKAPPSSRLGRNKGFSRGPGAPASPSASHPQGLDTTPKPH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGAP4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 105 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ARHGAP4 Antibody - BSA Free

• RGC1
• Rho GTPase activating protein 4

Background

The ARHGAP4 gene encodes a member of the rhoGAP family of proteins which play a role in the regulation of small GTP-bindingproteins belonging to the RAS superfamily. The protein encoded by the orthologous gene in rat is localized to theGolgi complex and can redi

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARHGAP4