ARHGAP28 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ARHGAP28 Antibody [NBP1-84642] - Immunofluorescent staining of human cell line CACO-2 shows localization to cell junctions.

Immunohistochemistry-Paraffin: ARHGAP28 Antibody [NBP1-84642] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in subsets of cells in seminiferus ducts.

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line CACO-2

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARHGAP28 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KQSIRDVRDIFGVSESPPRDTCGNHTNQLDGTKEERELPRVIKTSGSMPDDASLNSTTLSDASQDKEGSFAVPRSDSVAILETIP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGAP28
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ARHGAP28 Protein (NBP1-84642PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ARHGAP28 Antibody - BSA Free

• DKFZp686A2038
• FLJ10312
• KIAA1314FLJ27160
• Rho GTPase activating protein 28
• rho GTPase-activating protein 28
• Rho-type GTPase-activating protein 28

Background

The ARHGAP28 gene encodes for a Rho GTPase-activating protein 28 that converts them to an inactive GDP-bound state. ARHGAP28 exists in four isoforms: isoform 1 is 729 amino acids long, 82 kDA; isoform 2 is 670 amino acids long, 75 kDA; isoform 3 is 545 amino acids long, nearly 62 kDA; isoform 5 is 570 amino acids long, 64 kDA (note, there is no isoform 4). ARHGAP28 functions in signal transduction and Rho GTPase cycle and has been investigated in various diseases such as benign meningioma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARHGAP28