FAM107A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FAM107A Antibody [NBP2-30589] - Staining of human cell line HUVEC TERT2 shows localization to nuclear speckles. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589] - Staining in human fallopian tube and liver tissues . Corresponding FAM107A RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589] - Staining of human cerebellum shows moderate to strong positivity.
Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589] - Staining of human fallopian tube shows nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589] - Staining of human hippocampus shows moderate to strong nuclear positivity in glial cells.
Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589] - Staining of human prostate shows moderate nuclear positivity.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

FAM107A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEER
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM107A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM107A Protein (NBP2-30589PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM107A Antibody

  • downregulated in renal cell carcinoma
  • DRR1family with sequence similarity 107 member A transcript
  • family with sequence similarity 107, member A
  • FLJ30158
  • FLJ45473
  • Protein TU3A
  • TU3ADown-regulated in renal cell carcinoma 1

Background

FAM107A (Family With Sequence Similarity 107, Member A) is thought to have a role in tumor suppression. FAM107A is known to have interactions with CCDC85B, KRT15, NINL, TRIM37 and EFEMP2. FAM107A has been studied in relation to renal cell carcinoma, rheumatoid arthritis, meningioma, neuroblastoma and several other diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM107A Antibody (NBP2-30589) (0)

There are no publications for FAM107A Antibody (NBP2-30589).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM107A Antibody (NBP2-30589) (0)

There are no reviews for FAM107A Antibody (NBP2-30589). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM107A Antibody (NBP2-30589) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM107A Products

Research Areas for FAM107A Antibody (NBP2-30589)

Find related products by research area.

Blogs on FAM107A

There are no specific blogs for FAM107A, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM107A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM107A
Uniprot