FAM107A Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: FAM107A Antibody [NBP2-30589] - Staining of human cell line HUVEC TERT2 shows localization to nuclear speckles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589] - Staining in human fallopian tube and liver tissues . Corresponding FAM107A RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589] - Staining of human cerebellum shows moderate to strong positivity.

Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589] - Staining of human fallopian tube shows nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589] - Staining of human hippocampus shows moderate to strong nuclear positivity in glial cells.

Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589] - Staining of human prostate shows moderate nuclear positivity.

• Reactivity: Hu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FAM107A Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEER
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAM107A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FAM107A Protein (NBP2-30589PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FAM107A Antibody - BSA Free

• downregulated in renal cell carcinoma
• DRR1family with sequence similarity 107 member A transcript
• family with sequence similarity 107, member A
• FLJ30158
• FLJ45473
• Protein TU3A
• TU3ADown-regulated in renal cell carcinoma 1

Background

FAM107A (Family With Sequence Similarity 107, Member A) is thought to have a role in tumor suppression. FAM107A is known to have interactions with CCDC85B, KRT15, NINL, TRIM37 and EFEMP2. FAM107A has been studied in relation to renal cell carcinoma, rheumatoid arthritis, meningioma, neuroblastoma and several other diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FAM107A
• Uniprot:
  • O95990(Human)