FAM107A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FAM107A Antibody [NBP2-30589] - Staining of human cell line HUVEC TERT2 shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589] - Staining of human hippocampus shows moderate to strong nuclear positivity in glial cells.
Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589] - Staining of human cerebellum shows moderate to strong positivity.
Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589] - Staining of human prostate shows moderate nuclear positivity.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM107A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEER
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM107A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM107A Protein (NBP2-30589PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM107A Antibody

  • downregulated in renal cell carcinoma
  • DRR1family with sequence similarity 107 member A transcript
  • family with sequence similarity 107, member A
  • FLJ30158
  • FLJ45473
  • Protein TU3A
  • TU3ADown-regulated in renal cell carcinoma 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-55339
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90174
Species: Hu
Applications: IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
AF2396
Species: Hu
Applications: WB, Simple Western, IHC
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP2-02651
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88535
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42526
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA, S-ELISA, ELISA(Cap), ELISA(Det)
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-90998
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB3777
Species: Hu, Mu, Rt
Applications: WB
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-60103
Species: Hu
Applications: WB, IHC
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-30589
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for FAM107A Antibody (NBP2-30589) (0)

There are no publications for FAM107A Antibody (NBP2-30589).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM107A Antibody (NBP2-30589) (0)

There are no reviews for FAM107A Antibody (NBP2-30589). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM107A Antibody (NBP2-30589) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM107A Products

Bioinformatics Tool for FAM107A Antibody (NBP2-30589)

Discover related pathways, diseases and genes to FAM107A Antibody (NBP2-30589). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM107A Antibody (NBP2-30589)

Discover more about diseases related to FAM107A Antibody (NBP2-30589).
 

Pathways for FAM107A Antibody (NBP2-30589)

View related products by pathway.

PTMs for FAM107A Antibody (NBP2-30589)

Learn more about PTMs related to FAM107A Antibody (NBP2-30589).

Blogs on FAM107A

There are no specific blogs for FAM107A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM107A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM107A
Uniprot