ARHGAP28 Antibody

Images

 
Immunohistochemistry-Paraffin: ARHGAP28 Antibody [NBP1-84641] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in a subset of cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGAP28 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KSIPRCRRINRMLSNESLHPPAFSRSNSEASVDSASMEDFWREIESIKDSSMGGQEEPPPAEVTPVD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGAP28
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARHGAP28 Protein (NBP1-84641PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARHGAP28 Antibody

  • DKFZp686A2038
  • FLJ10312
  • KIAA1314FLJ27160
  • Rho GTPase activating protein 28
  • rho GTPase-activating protein 28
  • Rho-type GTPase-activating protein 28

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
AF2944
Species: Hu
Applications: WB, Simple Western
NBP1-84725
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-39100
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00001164-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF5928
Species: Hu
Applications: WB, IHC, ICC
NBP2-30589
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
NBP1-90642
Species: Hu
Applications: IHC, IHC-P
AF1177
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86731
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1448
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-06398
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ARHGAP28 Antibody (NBP1-84641) (0)

There are no publications for ARHGAP28 Antibody (NBP1-84641).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGAP28 Antibody (NBP1-84641) (0)

There are no reviews for ARHGAP28 Antibody (NBP1-84641). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ARHGAP28 Antibody (NBP1-84641) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARHGAP28 Products

Bioinformatics Tool for ARHGAP28 Antibody (NBP1-84641)

Discover related pathways, diseases and genes to ARHGAP28 Antibody (NBP1-84641). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGAP28 Antibody (NBP1-84641)

Discover more about diseases related to ARHGAP28 Antibody (NBP1-84641).
 

Pathways for ARHGAP28 Antibody (NBP1-84641)

View related products by pathway.

Blogs on ARHGAP28

There are no specific blogs for ARHGAP28, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGAP28 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP28