ARHGAP28 Antibody


Immunocytochemistry/ Immunofluorescence: ARHGAP28 Antibody [NBP1-84640] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm & cell junctions.
Immunohistochemistry-Paraffin: ARHGAP28 Antibody [NBP1-84640] - Staining in human testis and endometrium tissues using anti-ARHGAP28 antibody. Corresponding ARHGAP28 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ARHGAP28 Antibody [NBP1-84640] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: ARHGAP28 Antibody [NBP1-84640] - Staining of human testis shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

ARHGAP28 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VLPVHSNGSPEPGQPVQNAISDDDFLEKNIPPEAEELSFEVSYSEMVTEALKRNKLKKSEIKKEDYVLTKFNVQKTRFGL
Specificity of human ARHGAP28 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARHGAP28 Protein (NBP1-84640PEP)
Read Publication using NBP1-84640.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23276153)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ARHGAP28 Antibody

  • DKFZp686A2038
  • FLJ10312
  • KIAA1314FLJ27160
  • Rho GTPase activating protein 28
  • rho GTPase-activating protein 28
  • Rho-type GTPase-activating protein 28


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ARHGAP28 Antibody (NBP1-84640)(1)

Reviews for ARHGAP28 Antibody (NBP1-84640) (0)

There are no reviews for ARHGAP28 Antibody (NBP1-84640). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ARHGAP28 Antibody (NBP1-84640) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ARHGAP28 Products

Bioinformatics Tool for ARHGAP28 Antibody (NBP1-84640)

Discover related pathways, diseases and genes to ARHGAP28 Antibody (NBP1-84640). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGAP28 Antibody (NBP1-84640)

Discover more about diseases related to ARHGAP28 Antibody (NBP1-84640).

Pathways for ARHGAP28 Antibody (NBP1-84640)

View related products by pathway.

Blogs on ARHGAP28

There are no specific blogs for ARHGAP28, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ARHGAP28 Antibody and receive a gift card or discount.


Gene Symbol ARHGAP28