ARHGAP28 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ARHGAP28 Antibody [NBP1-84640] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm & cell junctions.

Immunohistochemistry-Paraffin: ARHGAP28 Antibody [NBP1-84640] - Staining of human testis shows high expression.

Analysis in human testis and tonsil tissues using HPA030413 antibody. Corresponding ARHGAP28 RNA-seq data are presented for the same tissues.

Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.

Staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARHGAP28 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ARHGAP28 Antibody - BSA Free (NBP1-84640) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-ARHGAP28 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VLPVHSNGSPEPGQPVQNAISDDDFLEKNIPPEAEELSFEVSYSEMVTEALKRNKLKKSEIKKEDYVLTKFNVQKTRFGL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGAP28
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ARHGAP28 Protein (NBP1-84640PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23276153)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ARHGAP28 Antibody - BSA Free

• DKFZp686A2038
• FLJ10312
• KIAA1314FLJ27160
• Rho GTPase activating protein 28
• rho GTPase-activating protein 28
• Rho-type GTPase-activating protein 28

Background

The ARHGAP28 gene encodes for a Rho GTPase-activating protein 28 that converts them to an inactive GDP-bound state. ARHGAP28 exists in four isoforms: isoform 1 is 729 amino acids long, 82 kDA; isoform 2 is 670 amino acids long, 75 kDA; isoform 3 is 545 amino acids long, nearly 62 kDA; isoform 5 is 570 amino acids long, 64 kDA (note, there is no isoform 4). ARHGAP28 functions in signal transduction and Rho GTPase cycle and has been investigated in various diseases such as benign meningioma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARHGAP28 Antibody (NBP1-84640)(1)

Publication using NBP1-84640

• Fagerberg L, Oksvold P, Skogs M et al. Contribution of antibody-based protein profiling to the human Chromosome-centric Proteome Project (C-HPP). J Proteome Res 2013-06-07 [PMID: 23276153]

Bioinformatics

• Gene Symbol: ARHGAP28
• Entrez:
  • 79822(Human)
• Uniprot:
  • Q9P2N2(Human)