APPL Antibody

Images

 
Immunohistochemistry: APPL Antibody [NBP1-90123] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

APPL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRSESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APPL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
APPL Protein (NBP1-90123PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for APPL Antibody

  • Adapter protein containing PH domain, PTB domain and leucine zipper motif 1
  • adaptor protein containing pH domain, PTB domain and leucine zipper motif 1
  • adaptor protein, phosphotyrosine interaction, PH domain and leucine zippercontaining 1
  • AKT2 interactor
  • APPL
  • APPL1
  • APPLdip13-alpha
  • DCC-interacting protein 13-alpha
  • DIP 13 alpha
  • DIP13A
  • DIP13alpha
  • Dip13-alpha
  • KIAA1428
  • signaling adaptor protein DIP13alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89029
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00055198-B01P
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-28640
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-28641
Species: Hu, Mu, Rt, Mk
Applications: WB, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3129
Species: Hu
Applications: WB, IHC, IP
NBP2-19621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-36489
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P

Publications for APPL Antibody (NBP1-90123) (0)

There are no publications for APPL Antibody (NBP1-90123).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APPL Antibody (NBP1-90123) (0)

There are no reviews for APPL Antibody (NBP1-90123). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for APPL Antibody (NBP1-90123) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional APPL Products

Bioinformatics Tool for APPL Antibody (NBP1-90123)

Discover related pathways, diseases and genes to APPL Antibody (NBP1-90123). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APPL Antibody (NBP1-90123)

Discover more about diseases related to APPL Antibody (NBP1-90123).
 

Pathways for APPL Antibody (NBP1-90123)

View related products by pathway.

PTMs for APPL Antibody (NBP1-90123)

Learn more about PTMs related to APPL Antibody (NBP1-90123).

Blogs on APPL

There are no specific blogs for APPL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APPL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APPL1
Entrez
Uniprot