APLP-2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: APLP-2 Antibody [NBP1-89029] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: APLP-2 Antibody [NBP1-89029] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

APLP-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PYVAQEIQEEIDELLQEQRADMDQFTASISETPVDVRVSSEESEEIPPFHPFHPFPALPENEDTQPELYHPMK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APLP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/mlp
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
87 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
APLP-2 Protein (NBP1-89029PEP)
Publications
Read Publication using
NBP1-89029 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25586139).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for APLP-2 Antibody

  • amyloid beta (A4) precursor-like protein 2
  • amyloid precursor protein homolog HSD-2
  • Amyloid protein homolog
  • amyloid-like protein 2
  • APLP2
  • APLP-2
  • APPH
  • APPHCDEI box-binding protein
  • APPL2
  • CDEBP
  • WALPLP2
  • YWK-II

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
AF3129
Species: Hu
Applications: WB, IHC, IP
NB110-58360
Species: Hu, Mu, Rt
Applications: WB, IP
MAB7075
Species: Hu
Applications: WB
MAB931
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-41182
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-84700
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-62539
Species: Hu
Applications: WB
NBP1-89029
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for APLP-2 Antibody (NBP1-89029)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for APLP-2 Antibody (NBP1-89029) (0)

There are no reviews for APLP-2 Antibody (NBP1-89029). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for APLP-2 Antibody (NBP1-89029) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional APLP-2 Products

Bioinformatics Tool for APLP-2 Antibody (NBP1-89029)

Discover related pathways, diseases and genes to APLP-2 Antibody (NBP1-89029). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APLP-2 Antibody (NBP1-89029)

Discover more about diseases related to APLP-2 Antibody (NBP1-89029).
 

Pathways for APLP-2 Antibody (NBP1-89029)

View related products by pathway.

PTMs for APLP-2 Antibody (NBP1-89029)

Learn more about PTMs related to APLP-2 Antibody (NBP1-89029).
 

Research Areas for APLP-2 Antibody (NBP1-89029)

Find related products by research area.

Blogs on APLP-2

There are no specific blogs for APLP-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APLP-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APLP2
Entrez
Uniprot