Apoptosis enhancing nuclease Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Apoptosis enhancing nuclease Antibody [NBP2-14272] - Staining of human cell line Hep-G2 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: Apoptosis enhancing nuclease Antibody [NBP2-14272] - Staining of human skin shows strong cytoplasmic and nuclear positivity in melanocytes.

Order Details


    • Catalog Number
      NBP2-14272
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Apoptosis enhancing nuclease Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SLTIPNAKDVLRKRHKRRSRQHQRFMARKALLQEQGLLSMPPEPGSSPLP TPFGAATATEAASSGKQCLRAGSGSAP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AEN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For IF, Fixation/Permeabilization: PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Apoptosis enhancing nuclease Antibody

  • apoptosis enhancing nuclease
  • EC 3.1
  • EC 3.1.13.1
  • FLJ12484
  • FLJ12562
  • interferon stimulated exonuclease gene 20kDa-like 1
  • Interferon-stimulated 20 kDa exonuclease-like 1
  • ISG20L1apoptosis-enhancing nuclease
  • pp12744

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-15078
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-82287
Species: Hu
Applications: IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB120-2737
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF6897
Species: Hu, Mu
Applications: WB, IHC
AF5510
Species: Hu
Applications: WB
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56537
Species: Hu, Mu
Applications: WB, ChIP, IP
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-91969
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33169
Species: Hu, Mu
Applications: WB
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP

Publications for Apoptosis enhancing nuclease Antibody (NBP2-14272) (0)

There are no publications for Apoptosis enhancing nuclease Antibody (NBP2-14272).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apoptosis enhancing nuclease Antibody (NBP2-14272) (0)

There are no reviews for Apoptosis enhancing nuclease Antibody (NBP2-14272). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Apoptosis enhancing nuclease Antibody (NBP2-14272) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Apoptosis enhancing nuclease Products

Bioinformatics Tool for Apoptosis enhancing nuclease Antibody (NBP2-14272)

Discover related pathways, diseases and genes to Apoptosis enhancing nuclease Antibody (NBP2-14272). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apoptosis enhancing nuclease Antibody (NBP2-14272)

Discover more about diseases related to Apoptosis enhancing nuclease Antibody (NBP2-14272).
 

Pathways for Apoptosis enhancing nuclease Antibody (NBP2-14272)

View related products by pathway.

PTMs for Apoptosis enhancing nuclease Antibody (NBP2-14272)

Learn more about PTMs related to Apoptosis enhancing nuclease Antibody (NBP2-14272).

Blogs on Apoptosis enhancing nuclease

There are no specific blogs for Apoptosis enhancing nuclease, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Apoptosis enhancing nuclease Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AEN
Entrez
Uniprot