APOOL Antibody

Images

 
Genetic Strategies: Western Blot: APOOL Antibody [NBP1-89325] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading ...read more
Immunocytochemistry/ Immunofluorescence: APOOL Antibody [NBP1-89325] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: APOOL Antibody [NBP1-89325] - Staining of human rectum shows granular cytoplasmic positivity in glandular cells.
Western Blot: APOOL Antibody [NBP1-89325] - Analysis in human cell line HeLa.
Western Blot: APOOL Antibody [NBP1-89325] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: APOOL Antibody [NBP1-89325] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: APOOL Antibody [NBP1-89325] - Staining of human kidney shows granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: APOOL Antibody [NBP1-89325] - Staining of human pancreas shows granular cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: APOOL Antibody [NBP1-89325] - Staining of human placenta shows granular cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

APOOL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ATLGATVCYPVQSVIIAKVTAKKVYATSQQIFGAVKSLWTKSSKEESLPKPKEKTKLGSSSEIEVPAKTTHVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPKLMDHGQSHPED
Specificity
Specificity of human, mouse, rat APOOL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APOOL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Publications
Read Publications using NBP1-89325.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23704930)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for APOOL Antibody

  • AAIR8193
  • apolipoprotein O-like
  • chromosome X open reading frame 33
  • CXorf33
  • FAM121A
  • family with sequence similarity 121A
  • MGC129748
  • Protein FAM121A
  • UNQ8193

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92280
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2736
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-83302
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37262
Species: Hu, Rt
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NB300-817
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-22212
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
H00010210-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1280
Species: Mu
Applications: WB, Simple Western, IHC
AF2864
Species: Hu
Applications: WB, ICC
AF1543
Species: Hu
Applications: WB, IHC
NBP2-42864
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1992
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Gt, GP, Ha, Mk, Rb, Sh, Sq, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-84339
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004507-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-80804
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1936
Species: Hu
Applications: WB, IP

Publications for APOOL Antibody (NBP1-89325)(3)

Reviews for APOOL Antibody (NBP1-89325) (0)

There are no reviews for APOOL Antibody (NBP1-89325). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for APOOL Antibody (NBP1-89325) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional APOOL Products

Bioinformatics Tool for APOOL Antibody (NBP1-89325)

Discover related pathways, diseases and genes to APOOL Antibody (NBP1-89325). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APOOL Antibody (NBP1-89325)

Discover more about diseases related to APOOL Antibody (NBP1-89325).
 

Pathways for APOOL Antibody (NBP1-89325)

View related products by pathway.

Blogs on APOOL

There are no specific blogs for APOOL, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APOOL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APOOL
Entrez
Uniprot
COVID-19 update