TOPORS Antibody (5G11)

Images

 
Western Blot: TOPORS Antibody (5G11) [H00010210-M01] - TOPORS expression in HeLa NE ( Cat # L013V3 ).
Immunocytochemistry/ Immunofluorescence: TOPORS Antibody (5G11) [H00010210-M01] - Analysis of monoclonal antibody to TOPORS on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: TOPORS Antibody (5G11) [H00010210-M01] - Analysis of monoclonal antibody to TOPORS on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma. Antibody concentration 3 ...read more
ELISA: TOPORS Antibody (5G11) [H00010210-M01] - Detection limit for recombinant GST tagged TOPORS is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
5G11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TOPORS Antibody (5G11) Summary

Immunogen
TOPORS (NP_005793, 98 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT
Specificity
TOPORS - topoisomerase I binding, arginine/serine-rich
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TOPORS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publications using H00010210-M01.

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TOPORS Antibody (5G11)

  • EC 6.3.2.-
  • LUNtopoisomerase I binding, arginine/serine-rich
  • p53-binding protein 3
  • p53BP3
  • retinitis pigmentosa 31 (autosomal dominant)
  • RP31
  • SUMO1-protein E3 ligase Topors
  • topoisomerase I binding, arginine/serine-rich, E3 ubiquitin protein ligase
  • Topoisomerase I-binding arginine/serine-rich protein
  • Topoisomerase I-binding RING finger protein
  • TP53BPLE3 ubiquitin-protein ligase Topors
  • Tumor suppressor p53-binding protein 3

Background

TOPORS functions as an ubiquitin-protein E3 ligase and as an E3 SUMO1-protein ligase. Can both ubiquitinate and sumoylate p53

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TOPORS Antibody (H00010210-M01)(3)

Reviews for TOPORS Antibody (H00010210-M01) (0)

There are no reviews for TOPORS Antibody (H00010210-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TOPORS Antibody (H00010210-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TOPORS Products

Array H00010210-M01

Research Areas for TOPORS Antibody (H00010210-M01)

Find related products by research area.

Blogs on TOPORS

There are no specific blogs for TOPORS, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TOPORS Antibody (5G11) and receive a gift card or discount.

Bioinformatics

Gene Symbol TOPORS
Entrez
Uniprot