Apolipoprotein L1 Antibody

Images

 
Western Blot: Apolipoprotein L1 Antibody [NBP1-89033] - Analysis in human plasma.
Immunohistochemistry-Paraffin: Apolipoprotein L1 Antibody [NBP1-89033] - Immunohistochemical staining of human skin shows positivity in plasma.
Immunohistochemistry-Paraffin: Apolipoprotein L1 Antibody [NBP1-89033] - Immunohistochemical staining of human colon shows positivity in plasma.
Simple Western: Apolipoprotein L1 Antibody [NBP1-89033] - Simple Western lane view shows a specific band for APOL1 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under ...read more
Simple Western: Apolipoprotein L1 Antibody [NBP1-89033] - Electropherogram image(s) of corresponding Simple Western lane view. Apolipoprotein L1 antibody was used at 1:30 dilution on RT-4 and U-251MG sp lysates(s).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Apolipoprotein L1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SNFLSLAGNTYQLTRGIGKDIRALRRARANLQSVPHASASRPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APOL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:30
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
Apolipoprotein L1 Protein (NBP1-89033PEP)
Publications
Read Publications using NBP1-89033.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23300552)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Apolipoprotein L1 Antibody

  • APOL
  • APO-L
  • APOL-I
  • Apolipoprotein L
  • apolipoprotein L, 1
  • apolipoprotein L1
  • Apolipoprotein L-I
  • FSGS4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31733
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-51595
Species: Hu
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01367
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-00092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-Fr, PLA
NB100-2270
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF4409
Species: Mu
Applications: WB
NBP1-89818
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-90127
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA

Publications for Apolipoprotein L1 Antibody (NBP1-89033)(2)

Reviews for Apolipoprotein L1 Antibody (NBP1-89033) (0)

There are no reviews for Apolipoprotein L1 Antibody (NBP1-89033). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apolipoprotein L1 Antibody (NBP1-89033) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Apolipoprotein L1 Products

Bioinformatics Tool for Apolipoprotein L1 Antibody (NBP1-89033)

Discover related pathways, diseases and genes to Apolipoprotein L1 Antibody (NBP1-89033). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein L1 Antibody (NBP1-89033)

Discover more about diseases related to Apolipoprotein L1 Antibody (NBP1-89033).
 

Pathways for Apolipoprotein L1 Antibody (NBP1-89033)

View related products by pathway.

PTMs for Apolipoprotein L1 Antibody (NBP1-89033)

Learn more about PTMs related to Apolipoprotein L1 Antibody (NBP1-89033).

Blogs on Apolipoprotein L1

There are no specific blogs for Apolipoprotein L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Apolipoprotein L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APOL1