Apolipoprotein H/ApoH Antibody

Images

 
Genetic Strategies: Western Blot: Apolipoprotein H/ApoH Antibody [NBP1-90045] - Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is ...read more
Immunohistochemistry-Paraffin: Apolipoprotein H/ApoH Antibody [NBP1-90045] - Staining of human kidney.
Independent Antibodies: Immunohistochemistry-Paraffin: Apolipoprotein H/ApoH Antibody [NBP1-90045] - Staining of human colon, kidney, lung and lymph node using Anti-APOH antibody NBP1-90045 (A) shows similar ...read more
Immunohistochemistry-Paraffin: Apolipoprotein H/ApoH Antibody [NBP1-90045] - Staining of human colon.
Immunohistochemistry-Paraffin: Apolipoprotein H/ApoH Antibody [NBP1-90045] - Staining of human lymph node.
Immunohistochemistry-Paraffin: Apolipoprotein H/ApoH Antibody [NBP1-90045] - Staining of human lung.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Apolipoprotein H/ApoH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITC
Specificity
Specificity of human Apolipoprotein H/ApoH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APOH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publication using NBP1-90045.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Apolipoprotein H/ApoH Antibody

  • Activated protein C-binding protein
  • Anticardiolipin cofactor
  • APC inhibitor
  • APOH
  • apo-H
  • apolipoprotein H (beta-2-glycoprotein I)
  • Apolipoprotein H
  • B2G1
  • B2GP1
  • B2GPI
  • Beta
  • beta(2)GPI
  • beta-2-glycoprotein 1
  • Beta-2-glycoprotein I
  • BG

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC, IHC-P
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-89200
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-58268
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB5376
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-32555
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75633
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu

Publications for Apolipoprotein H/ApoH Antibody (NBP1-90045)(1)

Reviews for Apolipoprotein H/ApoH Antibody (NBP1-90045) (0)

There are no reviews for Apolipoprotein H/ApoH Antibody (NBP1-90045). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apolipoprotein H/ApoH Antibody (NBP1-90045) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Apolipoprotein H/ApoH Products

Bioinformatics Tool for Apolipoprotein H/ApoH Antibody (NBP1-90045)

Discover related pathways, diseases and genes to Apolipoprotein H/ApoH Antibody (NBP1-90045). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein H/ApoH Antibody (NBP1-90045)

Discover more about diseases related to Apolipoprotein H/ApoH Antibody (NBP1-90045).
 

Pathways for Apolipoprotein H/ApoH Antibody (NBP1-90045)

View related products by pathway.

PTMs for Apolipoprotein H/ApoH Antibody (NBP1-90045)

Learn more about PTMs related to Apolipoprotein H/ApoH Antibody (NBP1-90045).
 

Research Areas for Apolipoprotein H/ApoH Antibody (NBP1-90045)

Find related products by research area.

Blogs on Apolipoprotein H/ApoH

There are no specific blogs for Apolipoprotein H/ApoH, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Apolipoprotein H/ApoH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APOH
Entrez
Uniprot
COVID-19 update