APMAP Antibody - BSA Free

Western Blot: APMAP Antibody [NBP1-59984] - HepG2 cell lysate, concentration 1.25ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

APMAP Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to C20ORF3 The peptide sequence was selected from the C terminal of C20ORF3 (NP_065392). Peptide sequence QETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APMAP
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 46 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for APMAP Antibody - BSA Free

• adipocyte plasma membrane-associated protein
• APMAP
• BSCv
• chromosome 20 open reading frame 3
• Protein BSCv

Background

C20orf3 may play a role in adipocyte differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for APMAP Antibody (NBP1-59984). (Showing 1 - 1 of 1 FAQ).

1. I would like to purchase one of your antibodies, but before I do I have some questions. The antibody I'm talking about is raised against APMAP (C20orf3). I've seen that I can select between 3 different antibodies (NBP1-59983, N00057136-B101P, NBP1-59984). Coming to my questions. I'm working mainly with murine cells and tissues and I've seen that your antibodies are just predicted to raise against mouse-Apmap. Furthermore, in addition to western blotting I would like to use this antibody for immunofluorescence of cells. Which one would you suggest to use? 
   • In regards to your inquiry I would recommend either NBP1-59983 or NBP1-59984 as they have been validated in murine samples; you would just need to decide if you prefer a C-term or an N-term target. Catalog number H00057136-B01P has only been validated for human samples so it would not be guaranteed in mouse. If you plan on doing IF as well we have a program called our Innovator's Reward program that you may want to take advantage of.

Bioinformatics

• Gene Symbol: APMAP
• Entrez:
  • 57136(Human)
• Uniprot:
  • Q9HDC9(Human)