APMAP Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse APMAP Antibody - Azide and BSA Free (H00057136-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
C20orf3 (NP_065392.1, 1 a.a. - 416 a.a.) full-length human protein. MSEADGLRQRRPLRPQVVTDDDGQAPEAKDGSSFSGRVFRVTFLMLAVSLTVPLLGAMMLLESPIDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKLFSQETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYLGSFRSPFLCRLSLQAV |
| Specificity |
C20orf3 - chromosome 20 open reading frame 3, |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
APMAP |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for APMAP Antibody - Azide and BSA Free
Background
Exhibits strong arylesterase activity with beta-naphthyl acetate and phenyl acetate. May play a role inadipocyte differentiation
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ChIP, ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow-CS, Flow, ICC/IF
Species: Hu
Applications: WB
Publications for APMAP Antibody (H00057136-B01P) (0)
There are no publications for APMAP Antibody (H00057136-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for APMAP Antibody (H00057136-B01P) (0)
There are no reviews for APMAP Antibody (H00057136-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for APMAP Antibody (H00057136-B01P). (Showing 1 - 1 of 1 FAQ).
-
I would like to purchase one of your antibodies, but before I do I have some questions. The antibody I'm talking about is raised against APMAP (C20orf3). I've seen that I can select between 3 different antibodies (NBP1-59983, N00057136-B101P, NBP1-59984). Coming to my questions. I'm working mainly with murine cells and tissues and I've seen that your antibodies are just predicted to raise against mouse-Apmap. Furthermore, in addition to western blotting I would like to use this antibody for immunofluorescence of cells. Which one would you suggest to use?
- In regards to your inquiry I would recommend either NBP1-59983 or NBP1-59984 as they have been validated in murine samples; you would just need to decide if you prefer a C-term or an N-term target. Catalog number H00057136-B01P has only been validated for human samples so it would not be guaranteed in mouse. If you plan on doing IF as well we have a program called our Innovator's Reward program that you may want to take advantage of.
Secondary Antibodies
| |
Isotype Controls
|
Additional APMAP Products
Research Areas for APMAP Antibody (H00057136-B01P)
Find related products by research area.
|
Blogs on APMAP