APMAP Antibody - Azide and BSA Free

Western Blot: APMAP Antibody [H00057136-B01P] - Analysis of C20orf3 expression in human liver.

Western Blot: APMAP Antibody [H00057136-B01P] - Analysis of C20orf3 expression in A-431.

Western Blot: APMAP Antibody [H00057136-B01P] - Analysis of C20orf3 expression in transfected 293T cell line by C20orf3 polyclonal antibody. Lane 1: C20orf3 transfected lysate(45.76 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

APMAP Antibody - Azide and BSA Free Summary

• Immunogen: C20orf3 (NP_065392.1, 1 a.a. - 416 a.a.) full-length human protein. MSEADGLRQRRPLRPQVVTDDDGQAPEAKDGSSFSGRVFRVTFLMLAVSLTVPLLGAMMLLESPIDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKLFSQETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYLGSFRSPFLCRLSLQAV
• Specificity: C20orf3 - chromosome 20 open reading frame 3,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: APMAP
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for APMAP Antibody - Azide and BSA Free

• adipocyte plasma membrane-associated protein
• APMAP
• BSCv
• chromosome 20 open reading frame 3
• Protein BSCv

Background

Exhibits strong arylesterase activity with beta-naphthyl acetate and phenyl acetate. May play a role inadipocyte differentiation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for APMAP Antibody (H00057136-B01P). (Showing 1 - 1 of 1 FAQ).

1. I would like to purchase one of your antibodies, but before I do I have some questions. The antibody I'm talking about is raised against APMAP (C20orf3). I've seen that I can select between 3 different antibodies (NBP1-59983, N00057136-B101P, NBP1-59984). Coming to my questions. I'm working mainly with murine cells and tissues and I've seen that your antibodies are just predicted to raise against mouse-Apmap. Furthermore, in addition to western blotting I would like to use this antibody for immunofluorescence of cells. Which one would you suggest to use? 
   • In regards to your inquiry I would recommend either NBP1-59983 or NBP1-59984 as they have been validated in murine samples; you would just need to decide if you prefer a C-term or an N-term target. Catalog number H00057136-B01P has only been validated for human samples so it would not be guaranteed in mouse. If you plan on doing IF as well we have a program called our Innovator's Reward program that you may want to take advantage of.

Bioinformatics

• Gene Symbol: APMAP
• Entrez:
  • 57136(Human)
• Uniprot:
  • NP_065392.1(Human)