APE Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: APE Antibody [NBP2-76495] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

APE Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQEGAPHR
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APEX1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for APE Antibody

  • AP endonuclease 1
  • APE
  • APE1
  • APE-1
  • APEAPEX nuclease (multifunctional DNA repair enzyme)
  • APENAP endonuclease class I
  • APEX deoxyribonuclease (apurinic or apyrimidinic)
  • APEX nuclease (multifunctional DNA repair enzyme) 1
  • APEX nuclease
  • APEX1
  • Apurinic-apyrimidinic endonuclease 1
  • APXAP lyase
  • DNA-(apurinic or apyrimidinic site) lyase
  • EC 3.1
  • EC 4.2.99.18
  • HAP1apurinic/apyrimidinic (abasic) endonuclease
  • multifunctional DNA repair enzyme
  • protein REF-1
  • redox factor 1
  • Redox factor-1
  • REF1 apurinic/apyrimidinic exonuclease
  • REF-1

Background

DNA-(apurinic or apyrimidinic site) lyase, also known as APE1 or APEX1, is a multifunctional mammalian proteins responsible for the cellular response to oxidative stress. Specifically, APE-1 both functions in the DNA base excision repair pathway and regulates the redox of transcriptional factors.

For DNA repair, APE1 functions as a mammalian apurinic/apyrimidinic (AP) endodeoxyribonuclease responsible for the repair of AP sites in DNA lesions induced by oxidative and alkylating agents.

APEX1 also exerts a reversible nuclear redox activity to regulate the DNA binding affinity and the activity of transcriptional factors by regulating the redox status of their DNA-binding domains.

APE1 antibodies are useful for studies on both DNA repair and transcriptional regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB100-106
Species: Hu, Mu, Po, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-38600
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87154
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-16182
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF2214
Species: Hu
Applications: ICC, IHC, WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-1031
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-76495
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for APE Antibody (NBP2-76495) (0)

There are no publications for APE Antibody (NBP2-76495).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APE Antibody (NBP2-76495) (0)

There are no reviews for APE Antibody (NBP2-76495). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for APE Antibody (NBP2-76495) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional APE Products

Bioinformatics Tool for APE Antibody (NBP2-76495)

Discover related pathways, diseases and genes to APE Antibody (NBP2-76495). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APE Antibody (NBP2-76495)

Discover more about diseases related to APE Antibody (NBP2-76495).
 

Pathways for APE Antibody (NBP2-76495)

View related products by pathway.

PTMs for APE Antibody (NBP2-76495)

Learn more about PTMs related to APE Antibody (NBP2-76495).
 

Research Areas for APE Antibody (NBP2-76495)

Find related products by research area.

Blogs on APE

There are no specific blogs for APE, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APEX1