Annexin A13 Antibody

Images

 
Western Blot: Annexin A13 Antibody [NBP1-90157] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-37
Immunocytochemistry/ Immunofluorescence: Annexin A13 Antibody [NBP1-90157] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.
Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90157] - Staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Annexin A13 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CTRTNKEIIAIKEAYQRLFDRSLESDVKGDTSGNLKKILVSLLQANRNEGDDVDKDLAGQDAKDLYDAGEGRWGTDEL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANXA13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Annexin A13 Protein (NBP1-90157PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Annexin A13 Antibody

  • Annexin A13
  • Annexin XIII
  • Annexin-13
  • ANX13
  • ANX13annexin, intestine-specific
  • ANXA13
  • Intestine-specific annexin
  • ISA
  • ISAannexin-13
  • MGC150460

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
AF3927
Species: Hu, Mu, Rt
Applications: WB
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
AF4146
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF8105
Species: Hu
Applications: WB, IHC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-90155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005457-M04
Species: Hu
Applications: WB, ELISA
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-03263
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89716
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90157
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Annexin A13 Antibody (NBP1-90157) (0)

There are no publications for Annexin A13 Antibody (NBP1-90157).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Annexin A13 Antibody (NBP1-90157) (0)

There are no reviews for Annexin A13 Antibody (NBP1-90157). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Annexin A13 Antibody (NBP1-90157) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Annexin A13 Products

Bioinformatics Tool for Annexin A13 Antibody (NBP1-90157)

Discover related pathways, diseases and genes to Annexin A13 Antibody (NBP1-90157). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Annexin A13 Antibody (NBP1-90157)

Discover more about diseases related to Annexin A13 Antibody (NBP1-90157).
 

Pathways for Annexin A13 Antibody (NBP1-90157)

View related products by pathway.

Blogs on Annexin A13

There are no specific blogs for Annexin A13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Annexin A13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANXA13
Entrez
Uniprot