HBLD1 Antibody

Images

 
Western Blot: HBLD1 Antibody [NBP1-89716] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: HBLD1 Antibody [NBP1-89716] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HBLD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RGRLLTASLGPQARREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ISCA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HBLD1 Protein (NBP1-89716PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HBLD1 Antibody

  • c14_5557
  • HBLD1
  • HesB like domain containing 1
  • HESB-like domain-containing protein 1
  • iron-sulfur cluster assembly 2 homolog (S. cerevisiae)
  • iron-sulfur cluster assembly 2 homolog, mitochondrial
  • ISA2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4149
Species: Hu, Mu
Applications: WB
NBP1-94027
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NBP1-83954
Species: Hu
Applications: IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32442
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31775
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46222
Species: Hu
Applications: WB, IHC, IF
NBP2-33413
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30003
Species: Hu
Applications: WB, ICC/IF, IHC-P
AF6637
Species: Mu
Applications: WB, IHC
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NBP2-46161
Species: Hu
Applications: WB, IHC
NBP1-89716
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HBLD1 Antibody (NBP1-89716) (0)

There are no publications for HBLD1 Antibody (NBP1-89716).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HBLD1 Antibody (NBP1-89716) (0)

There are no reviews for HBLD1 Antibody (NBP1-89716). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HBLD1 Antibody (NBP1-89716) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HBLD1 Products

Bioinformatics Tool for HBLD1 Antibody (NBP1-89716)

Discover related pathways, diseases and genes to HBLD1 Antibody (NBP1-89716). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HBLD1 Antibody (NBP1-89716)

Discover more about diseases related to HBLD1 Antibody (NBP1-89716).
 

Pathways for HBLD1 Antibody (NBP1-89716)

View related products by pathway.

Blogs on HBLD1

There are no specific blogs for HBLD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HBLD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ISCA2