Annexin A11 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Annexin A11 Antibody [NBP1-90160] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: Annexin A11 Antibody [NBP1-90160] - Staining of human tonsil shows moderate cytoplasmic positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: Annexin A11 Antibody [NBP1-90160] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: Annexin A11 Antibody [NBP1-90160] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Staining of human pancreas shows strong cytoplasmic positivity in intercalated ducts.

Analysis in human cell line PC-3.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Annexin A11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Annexin A11 Antibody - BSA Free (NBP1-90160) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANXA11
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 54 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  Annexin A11 Protein (NBP1-90160PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Annexin A11 Antibody - BSA Free

• Annexin A11
• Annexin-11
• ANX1156-kD
• ANXA11
• CAP50
• CAP-50

Background

Annexin A11 is a member of the annexin family, a group of calcium-dependent phospholipid-binding proteins. Annexins have unique N-terminal domains and conserved C-terminal domains, which contain the calcium-dependent phospholipid-binding sites. The encoded protein is a 56-kD antigen recognized by sera from patients with various autoimmune diseases. Transcript variants encoding the same isoform have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANXA11
• Entrez:
  • 311(Human)
• Uniprot:
  • P50995()