ANKRD55 Antibody

Images

 
Immunohistochemistry-Paraffin: ANKRD55 Antibody [NBP2-14719] - Staining of human lymph node shows moderate cytoplasmic positivity in non-germinal center cells.
Western Blot: ANKRD55 Antibody [NBP2-14719] -Analysis in human cell line NB4.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANKRD55 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: SLPPITLGNNFLTASHRATSHAGLSSAPHHMAQRSQKSRSEQDLLNNRTGCQMLLDNPWKSDSNQVFSYKVWTVSSSDKLLDRLLSVR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKRD55
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ANKRD55 Protein (NBP2-14719PEP)
Publications
Read Publications using
NBP2-14719 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANKRD55 Antibody

  • ANKRD55 ankyrin repeat domain 55

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB342
Species: Hu
Applications: AgAct, ICC, WB
NBP1-87714
Species: Hu
Applications: IHC, IHC-P
MAB3428
Species: Hu
Applications: IHC, WB
DR2A00
Species: Hu
Applications: ELISA
NBP2-45312
Species: Hu, Pm, Mu(-)
Applications: Flow, ICC/IF, IF, IHC, IHC-P, WB
NBP2-14093
Species: Hu
Applications: IHC, IHC-P, WB
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00000640-M02
Species: Hu, Mu, Rt
Applications: ELISA, Flow, WB
NBP3-07168
Species: Pm, Ca, Pm, Hu, Pm, Sq
Applications: Flow, ICC/IF
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88826
Species: Hu
Applications: IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP1-05987
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, IP, KD, MiAr, Simple Western, Single-Cell Western, WB
7770-GT
Species: Hu
Applications: EnzAct
NBP1-77533
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB500-526
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP1-80740
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB195
Species: Hu
Applications: CyTOF-ready, Flow, IHC
NB100-77417
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, WB
366-6C/CF
Species: Hu
Applications: BA

Publications for ANKRD55 Antibody (NBP2-14719)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IF/IHC, IHC-P.


Filter By Application
IF/IHC
(1)
IHC-P
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for ANKRD55 Antibody (NBP2-14719) (0)

There are no reviews for ANKRD55 Antibody (NBP2-14719). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ANKRD55 Antibody (NBP2-14719) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ANKRD55 Products

Diseases for ANKRD55 Antibody (NBP2-14719)

Discover more about diseases related to ANKRD55 Antibody (NBP2-14719).
 

Pathways for ANKRD55 Antibody (NBP2-14719)

View related products by pathway.

Blogs on ANKRD55

There are no specific blogs for ANKRD55, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKRD55 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKRD55
Entrez
Uniprot