LAF4 Antibody - BSA Free Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KSQGEKDSSSRLATSTSNTLSANHCNMNINSVAIPINKNEKMLRSPISPLSDASKHKYTSEDLTSSSRPNGNSLFTSASSSKKPKADSQLQPHGGDLTKAAHNNSENIPLHKSRPQTKPWSPGSNGHRDCKRQKLVFDDMP |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
AFF3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
Application Notes |
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Publications |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for LAF4 Antibody - BSA Free
Background
The LAF4 gene encodes a tissue-restricted nuclear transcriptional activator that is preferentially expressed in lymphoid tissue. Isolation of this protein initially defined a highly conserved LAF4/MLLT2 gene family of nuclear transcription factors that may fu
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, IP (-), WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: CHIP-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF
Publications for LAF4 Antibody (NBP2-54913)(1)
Showing Publication 1 -
1 of 1.
Publication using NBP2-54913 |
Applications |
Species |
Yulan Deng, Liang Xia, Jian Zhang, Senyi Deng, Mengyao Wang, Shiyou Wei, Kaixiu Li, Hongjin Lai, Yunhao Yang, Yuquan Bai, Yongcheng Liu, Lanzhi Luo, Zhenyu Yang, Yaohui Chen, Ran Kang, Fanyi Gan, Qiang Pu, Jiandong Mei, Lin Ma, Feng Lin, Chenglin Guo, Hu Liao, Yunke Zhu, Zheng Liu, Chengwu Liu, Yang Hu, Yong Yuan, Zhengyu Zha, Gang Yuan, Gao Zhang, Luonan Chen, Qing Cheng, Shensi Shen, Lunxu Liu Multicellular ecotypes shape progression of lung adenocarcinoma from ground-glass opacity toward advanced stages Cell Reports Medicine 2024-03-29 [PMID: 38554705] |
|
|
Reviews for LAF4 Antibody (NBP2-54913) (0)
There are no reviews for LAF4 Antibody (NBP2-54913).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for LAF4 Antibody (NBP2-54913) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional LAF4 Products
Blogs on LAF4