ANKK1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ANKK1 Antibody [NBP1-86849] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: ANKK1 Antibody [NBP1-86849] - Staining of human testis shows cytoplasmic positivity in cells in seminiferus ducts and leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANKK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EVNEDISQELMDSDSGNYLKRALQLSDRKNLVPRDEELCIYENKVTPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQER
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ANKK1 Protein (NBP1-86849PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANKK1 Antibody

  • ankyrin repeat and kinase domain containing 1
  • ankyrin repeat and protein kinase domain-containing protein 1
  • EC 2.7.11
  • EC 2.7.11.1
  • PKK2
  • Protein kinase PKK2
  • SGK288
  • Sugen kinase 288
  • X-kinasesgK288

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP1-83693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-37397
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86849
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ANKK1 Antibody (NBP1-86849) (0)

There are no publications for ANKK1 Antibody (NBP1-86849).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKK1 Antibody (NBP1-86849) (0)

There are no reviews for ANKK1 Antibody (NBP1-86849). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ANKK1 Antibody (NBP1-86849) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ANKK1 Products

Bioinformatics Tool for ANKK1 Antibody (NBP1-86849)

Discover related pathways, diseases and genes to ANKK1 Antibody (NBP1-86849). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKK1 Antibody (NBP1-86849)

Discover more about diseases related to ANKK1 Antibody (NBP1-86849).
 

Pathways for ANKK1 Antibody (NBP1-86849)

View related products by pathway.

PTMs for ANKK1 Antibody (NBP1-86849)

Learn more about PTMs related to ANKK1 Antibody (NBP1-86849).

Blogs on ANKK1

There are no specific blogs for ANKK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKK1
Entrez
Uniprot