ANKH Antibody

Images

 
Western Blot: ANKH Antibody [NBP1-59748] - Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANKH Antibody Summary

Immunogen
Synthetic peptides corresponding to ANKH(ankylosis, progressive homolog (mouse)) The peptide sequence was selected from the N terminal of ANKH (NP_473368). Peptide sequence SDLGYYIINKLHHVDESVGSKTRRAFLYLAAFPFMDAMAWTHAGILLKHK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ANKH and was validated on Western blot.
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ANKH Antibody

  • ANKcraniometaphyseal dysplasia, Jackson type (dominant)
  • ankylosis, progressive (mouse) homolog
  • ankylosis, progressive homolog (mouse)
  • CCAL2
  • CMDJ
  • CPPDDFLJ27166
  • HANKMANK
  • KIAA1581
  • progressive ankylosis protein homolog

Background

ANKH regulates intra- and extracellular levels of inorganic pyrophosphate (PPi), probably functioning as PPi transporter.This gene encodes a multipass transmembrane protein that is expressed in joints and other tissues and controls pyrophosphate levels in cultured cells. Progressive ankylosis-mediated control of pyrophosphate levels has been suggested as a possible mechanism regulating tissue calcification and susceptibility to arthritis in higher animals. Mutations in this gene have been associated with autosomal dominant craniometaphyseal dysplasia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27561
Species: Hu, Rt, Ch
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
NBP2-38952
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52552
Species: Hu
Applications: IHC, IHC-P, IP, PEP-ELISA, IF
NB100-1793
Species: Hu, Mu, Pm
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
AF2910
Species: Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ICC
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
NBP1-32252
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP1-71805
Species: Hu
Applications: WB, IP
NBP1-45525
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ANKH Antibody (NBP1-59748) (0)

There are no publications for ANKH Antibody (NBP1-59748).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKH Antibody (NBP1-59748) (0)

There are no reviews for ANKH Antibody (NBP1-59748). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ANKH Antibody (NBP1-59748) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ANKH Products

Bioinformatics Tool for ANKH Antibody (NBP1-59748)

Discover related pathways, diseases and genes to ANKH Antibody (NBP1-59748). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKH Antibody (NBP1-59748)

Discover more about diseases related to ANKH Antibody (NBP1-59748).
 

Pathways for ANKH Antibody (NBP1-59748)

View related products by pathway.

PTMs for ANKH Antibody (NBP1-59748)

Learn more about PTMs related to ANKH Antibody (NBP1-59748).

Blogs on ANKH

There are no specific blogs for ANKH, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKH
Entrez
Uniprot
COVID-19 update