Angiopoietin-like Protein 1/ANGPTL1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Angiopoietin-like Protein 1/ANGPTL1 Antibody [NBP1-89088] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: Angiopoietin-like Protein 1/ANGPTL1 Antibody [NBP1-89088] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: Angiopoietin-like Protein 1/ANGPTL1 Antibody [NBP1-89088] - Staining of human lymph node shows no positivity in non - germinal center cells as expected.

Immunohistochemistry-Paraffin: Angiopoietin-like Protein 1/ANGPTL1 Antibody [NBP1-89088] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: Angiopoietin-like Protein 1/ANGPTL1 Antibody [NBP1-89088] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Angiopoietin-like Protein 1/ANGPTL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Angiopoietin-like Protein 1/ANGPTL1 Antibody - BSA Free (NBP1-89088) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LKMATRYRELEVKYASLTDLVNNQSVMITLLEEQCLRIFSRQDTHVSPPLVQVVPQHIPNSQQYTPGLLGGNEIQRDPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPENSNGPMQLWCENS
• Predicted Species: Mouse (90%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANGPTL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Angiopoietin-like Protein 1/ANGPTL1 Protein (NBP1-89088PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Angiopoietin-like Protein 1/ANGPTL1 Antibody - BSA Free

• ANG-3
• ANG3angioarrestin
• Angiopoietin like Protein 1
• angiopoietin Y1
• angiopoietin-3
• angiopoietin-like 1
• Angiopoietin-like Protein 1
• angiopoietin-related protein 1
• ANGPT3
• ANGPTL1
• AngY
• AngY1
• ARP1
• ARP1angiopoietin 3
• dJ595C2.2 (angiopoietin Y1)
• dJ595C2.2
• KIAA0351
• UNQ162

Background

Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. The protein encoded by this gene is another member of the angiopoietin family that is widely expressed in adult tissues with mRNA levels highest in highly vascularized tissues. This protein was found to be a secretory protein that does not act as an endothelial cell mitogen in vitro.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANGPTL1
• Entrez:
  • 9068(Human)
• Uniprot:
  • O95841()