AMPK beta 1 Antibody (2C3)

Images

 
Western Blot: AMPK beta 1 Antibody (2C3) [H00005564-M02] - PRKAB1 monoclonal antibody (M02), clone 2C3 Analysis of PRKAB1 expression in HeLa.
Immunocytochemistry/ Immunofluorescence: AMPK beta 1 Antibody (2C3) [H00005564-M02] - Analysis of monoclonal antibody to PRKAB1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: AMPK beta 1 Antibody (2C3) [H00005564-M02] - Detection limit for recombinant GST tagged PRKAB1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2C3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AMPK beta 1 Antibody (2C3) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
PRKAB1 (AAH01007, 1 a.a. ~ 270 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI
Specificity
PRKAB1 - protein kinase, AMP-activated, beta 1 non-catalytic subunit
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRKAB1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Reviewed Applications
Read 1 Review rated 5
using
H00005564-M02 in the following applications:

Reactivity Notes

Mouse reactivity reported from customer review. Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AMPK beta 1 Antibody (2C3)

  • 5'-AMP-activated protein kinase beta-1 subunit
  • AMP-activated protein kinase beta subunit
  • AMPK beta -1 chain
  • AMPK beta 1
  • AMPK beta 1,5'-AMP-activated protein kinase subunit beta-1
  • AMPK subunit beta-1
  • AMPK
  • AMPKb
  • HAMPKb
  • MGC17785
  • PRKAB1
  • protein kinase, AMP-activated, beta 1 non-catalytic subunit
  • protein kinase, AMP-activated, noncatalytic, beta-1

Background

The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for AMPK beta 1 Antibody (H00005564-M02) (0)

There are no publications for AMPK beta 1 Antibody (H00005564-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for AMPK beta 1 Antibody (H00005564-M02) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using H00005564-M02:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot AMPK beta 1 H00005564-M02
Enlarge
5
reviewed by:
Angel Lin
WB Mouse 04/01/2013
View

Summary

ApplicationWestern Blot
Sample TestedBrain, germ cells, Repro proteins
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AMPK beta 1 Antibody (H00005564-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AMPK beta 1 Products

Research Areas for AMPK beta 1 Antibody (H00005564-M02)

Find related products by research area.

Blogs on AMPK beta 1

There are no specific blogs for AMPK beta 1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Angel Lin
04/01/2013
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol PRKAB1
Entrez
OMIM
Uniprot