Home » AMPK beta 1 » AMPK beta 1 Antibodies » AMPK beta 1 Antibody (2C3)

AMPK beta 1 Antibody (2C3)

 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: AMPK beta 1 Antibody (2C3) [H00005564-M02] - PRKAB1 monoclonal antibody (M02), clone 2C3 Analysis of PRKAB1 expression in HeLa.
Western Blot: AMPK beta 1 Antibody (2C3) [H00005564-M02] - PRKAB1 monoclonal antibody (M02), clone 2C3 Analysis of PRKAB1 expression in HeLa.
Immunocytochemistry/ Immunofluorescence: AMPK beta 1 Antibody (2C3) [H00005564-M02] - Analysis of monoclonal antibody to PRKAB1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: AMPK beta 1 Antibody (2C3) [H00005564-M02] - Detection limit for recombinant GST tagged PRKAB1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
2C3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

AMPK beta 1 Antibody (2C3) Summary

Immunogen
PRKAB1 (AAH01007, 1 a.a. ~ 270 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI
Specificity
PRKAB1 - protein kinase, AMP-activated, beta 1 non-catalytic subunit
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRKAB1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Reviewed Applications
Read 1 Review rated 5
using
H00005564-M02 in the following applications:

Reactivity Notes

Mouse reactivity reported from customer review. Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AMPK beta 1 Antibody (2C3)

  • 5'-AMP-activated protein kinase beta-1 subunit
  • AMP-activated protein kinase beta subunit
  • AMPK beta -1 chain
  • AMPK beta 1
  • AMPK beta 1,5'-AMP-activated protein kinase subunit beta-1
  • AMPK subunit beta-1
  • AMPK
  • AMPKb
  • HAMPKb
  • MGC17785
  • PRKAB1
  • protein kinase, AMP-activated, beta 1 non-catalytic subunit
  • protein kinase, AMP-activated, noncatalytic, beta-1

Background

The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(14 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Brown arrow= IBa1 positive cells, Green arrow= mTOR positive cells, Black arrow= mTOR and IBA1 positive cells. IHC-P Image submitted by a verified customer review.
Western Blot: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Rapamycin reduces mTOR phosphorylation induced by TII. Whole-cell lysates were prepared from astrocytes activated with TII for 2 h. 10 nM Rapamycin was added at the beginning of the experiment and equal amounts of protein were analyzed by western blot for phosphorylated mTOR kinase (p-mTOR) (upper gel) and consequently for beta-actin (lower gel). Image collected and cropped by CiteAb from the following publication (http://jneuroinflammation.biomedcentral.com/articles/10.1186/1742-2094-8-1), licensed under a CC-BY licence.
N/A: TOR/mTOR [p Ser2448] Antibody [NB600-607]
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
LKB1/STK11
Antibody - BSA Free
NBP2-14835
Western Blot: LKB1 Antibody [NBP2-14835] - LKB1 antibody was tested in human testes lysate.
Immunohistochemistry-Paraffin: LKB1 Antibody [NBP2-14835] - LKB1 antibody was tested in mouse stomach using DAB with hematoxylin counterstain.
Immunocytochemistry/Immunofluorescence: LKB1 Antibody [NBP2-14835] - LKB1 antibody was tested in HepG2 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
ATIC Antibody
NBP1-89192
Western Blot: ATIC Antibody [NBP1-89192] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: ATIC Antibody [NBP1-89192] - Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ATIC antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: ATIC Antibody [NBP1-89192] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(27 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Adiponectin/Acrp30
[HRP]
DRP300
(6 Reviews)
(150 Publications)
Species: Hu
Applications: ELISA
Acetyl-CoA
Carboxylase alpha/ACA ...
NBP3-15744
Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Immunohistochemistry of paraffin-embedded rat kidney using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Immunohistochemistry of paraffin-embedded mouse testis using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Western Blot: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Western blot analysis of extracts of various cell lines, using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Glut4 Antibody -
BSA Free
NBP1-49533
Flow (Intracellular): Glut4 Antibody [NBP1-49533] - An intracellular stain was performed on HepG2 with NBP1-49533 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
Western Blot: Glut4 Antibody [NBP1-49533] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-Glut4 0.5 ug/ml in non-fat milk. Undiffer: undifferentiated; Differ: Differentiated. Image from verified customer review.
Western Blot: Glut4 Antibody [NBP1-49533] - Glycolysis-related genes and proteins were upregulated in differentiated podocytes. Representative blot images of glycolysis-related proteins (n =3). d All proteins were normalized to tubulin and compared to UDPs. *P < 0.05, **P < 0.01, determined by t test. Data are shown as the means +/- SD. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41419-020-2481-5), licensed under a CC-BY licence.
(4 Reviews)
(25 Publications)
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Sirtuin 1/SIRT1
Antibody (1F3) - BSA ...
NBP1-51641
Immunohistochemistry-Paraffin: Sirtuin 1/SIRT1 Antibody (1F3) [NBP1-51641] - Immunohistochemical analysis of paraffin-embedded lung cancer tissues (left) and kidney cancer tissues (right) using SIRT1 mouse mAb with DAB staining.
Flow Cytometry: Sirtuin 1/SIRT1 Antibody (1F3) [NBP1-51641] - Flow cytometric analysis of K562 cells using SIRT1 mouse mAb (green) and negative control (purple).
Immunocytochemistry/Immunofluorescence: Sirtuin 1/SIRT1 Antibody (1F3) [NBP1-51641] - Analysis of NTERA-2 cells using SIRT1 mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
(7 Publications)
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Leptin/OB [HRP]
DLP00
(8 Reviews)
(128 Publications)
Species: Hu
Applications: ELISA
ERK2 Antibody
(SZ25-01)
NBP2-67360
Flow Cytometry: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of Hela cells with ERK2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.
Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.
Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.
(2 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
eNOS Antibody -
BSA Free
NB300-500
Immunohistochemistry: eNOS Antibody [NB300-500] - Staining of representative pulmonary artery endothelial cells from rats subjected to CON=Control Group, ALI=Acute lung injury Group, LV=Low tidal volume Group, VLV=Very low tidal volume Group, MV=Large tidal volume Group. Dark brown staining of indicates eNOS-positive cells. Magnification x400.
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Expression of endothelial markers indicate functional endothelium in TEVG. Whole mount staining of native aorta and TEVG. VE-cadherin is a marker of cellular borders of endothelial cells (green). Endothelial nitric oxide synthase (eNOS) is a marker of a functional endothelium (red). DAPI is a nuclear stain (blue). Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0120328), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Staining of eNOS in human lung tissue.
(3 Reviews)
(20 Publications)
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Ribosomal Protein
S6/RPS6 Antibody
NB100-1595
Immunohistochemistry-Paraffin: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Section of human lung carcinoma. Antibody: Affinity purified rabbit anti-RPS6 (NB100-1595). Detection: DAB
Western Blot: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Detection of human and mouse RPS6 by western blot. Samples: Whole cell lysate (50 ug) from HeLa, HEK293T, Jurkat, mouse TCMK-1, and mouse NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-RPS6 antibody NB100-1595 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.Previous
Immunoprecipitation: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Detection of human RPS6 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-RPS6 antibody NB100-1595 (lot NB100-1595-2) used for IP at 6 ug per reaction. RPS6 was also immunoprecipitated by a previous lot of this antibody (lot NB100-1595-1). For blotting immunoprecipitated RPS6, NB100-1595 was used at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Fatty Acid
Synthase/FASN Antibod
NB400-114
Immunocytochemistry/Immunofluorescence: Fatty Acid Synthase/FASN Antibody [NB400-114] - Fatty acid synthesis requirement for CHIKV life cycle. Confocal section of CHIKV replicon-infected HeLa cells labelled for FASN, dsRNA and 4,6-diamidino-2-phenylindole (DAPI; blue). Scale bar, 10 um. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/doifinder/10.1038/ncomms11320), licensed under a CC-BY licence.
Western Blot: Fatty Acid Synthase/FASN Antibody [NB400-114] - Analysis of Fatty Acid Synthase, using NB400-114. Samples: 50 ug of total mouse liver lysate.
Immunohistochemistry-Paraffin: Fatty Acid Synthase/FASN Antibody [NB400-114] - Immunohistochemical localization of FAS in chicken hypothalmus. Paraffin sections were obtained from 3-wk-old broiler chickens.
(2 Reviews)
(24 Publications)
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
IL-6 [HRP]
D6050
(32 Reviews)
(605 Publications)
Species: Hu
Applications: ELISA
PYK2/FAK2 Antibody
(SC06-15)
NBP2-67627
Immunocytochemistry/Immunofluorescence: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Staining PYK2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X-100/PBS.
Immunocytochemistry/Immunofluorescence: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Staining PYK2 in SHG-44 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilized with 0.25% Triton X-100/PBS.
Immunocytochemistry/Immunofluorescence: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Staining PYK2 in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilized with 0.25% Triton X-100/PBS.
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(708 Publications)
Species: Hu
Applications: BA
AMPK beta 1
Antibody (2C3)
H00005564-M02
AMPK beta 1 Antibody (2C3)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for AMPK beta 1 Antibody (H00005564-M02) (0)

There are no publications for AMPK beta 1 Antibody (H00005564-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for AMPK beta 1 Antibody (H00005564-M02) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using H00005564-M02:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot AMPK beta 1 H00005564-M02
Enlarge 		5
reviewed by:
Angel Lin
 WB Mouse 04/01/2013
View

Summary

ApplicationWestern Blot
Sample Tested Brain, germ cells, Repro proteins
SpeciesMouse
CommentsAntibody worked well. Very simple process

Blocking

Blocking Details5% Non fat milk in TBST at RT for 1 hr

Primary Anitbody

Dilution Ratio1:500 in 5% non fat milk in TBST, 4C O/N

Secondary Antibody

Secondary Descriptionanti-mouse HRP
Secondary Concentration1:5000

Details

Detection NotesECL prime, 10 min exposure

Comments

CommentsAntibody worked well. Very simple process

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AMPK beta 1 Antibody (H00005564-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AMPK beta 1 Products

Bioinformatics Tool for AMPK beta 1 Antibody (H00005564-M02)

Discover related pathways, diseases and genes to AMPK beta 1 Antibody (H00005564-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMPK beta 1 Antibody (H00005564-M02)

Discover more about diseases related to AMPK beta 1 Antibody (H00005564-M02).
 

Pathways for AMPK beta 1 Antibody (H00005564-M02)

View related products by pathway.

PTMs for AMPK beta 1 Antibody (H00005564-M02)

Learn more about PTMs related to AMPK beta 1 Antibody (H00005564-M02).
 

Research Areas for AMPK beta 1 Antibody (H00005564-M02)

Find related products by research area.

Blogs on AMPK beta 1

There are no specific blogs for AMPK beta 1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
Western Blot AMPK beta 1 H00005564-M02
Enlarge
 Angel Lin
04/01/2013
Application: WB
Species: Mouse
read this review

Bioinformatics

Gene Symbol PRKAB1
Entrez
OMIM
Uniprot