AMPD3 Antibody

Immunocytochemistry/Immunofluorescence: AMPD3 Antibody [NBP2-14290] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & nuclear membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: AMPD3 Antibody [NBP2-14290] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

• Reactivity: Hu, Mu
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

AMPD3 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: DALSLFTVPEDCPIGQKEAKERELQKELAEQKSVETAKRKKSFKMIRSQSLSLQMPPQQDWKGPPAASPAMSPTTPVVTGATS
• Predicted Species: Mouse (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AMPD3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  AMPD3 Protein (NBP2-14290PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AMPD3 Antibody

• adenosine monophosphate deaminase (isoform E)
• adenosine monophosphate deaminase 3
• AMP aminohydrolase
• AMP deaminase 3
• AMP deaminase isoform E
• EC 3.5.4.6
• Erythrocyte AMP deaminase
• erythrocyte type AMP deaminase
• erythrocyte-specific AMP deaminase
• myoadenylate deaminase

Background

AMPD3, or Adenosine monophosphate deaminase 3, contains a 88 kDa, 24 kDa, 76 kDa, 90 kDa, 89 kDa, and 71 kDa isoform, and is involved in energy metabolism, where it catalyzes the reaction in which adenosine monophosphate transforms into inosine monophosphate. Research currently being conducted on AMPD3 includes its relation with a variety of diseases and disorders, including adenosine monophosphate deaminase deficiency, myopathy, Alzheimer's disease, adenocarcinoma, ischemia, erythrocyte amp deaminase deficiency, hepatocellular carcinoma, hypoxia, malaria, nephropathy, and metabolic disorders. This protein is associated with purine salvage and nucleotide metabolism, in which it interacts with ALB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AMPD3
• Entrez:
  • 272(Human)
• Uniprot:
  • Q01432(Human)