AMPD2 Antibody

Images

 
Immunohistochemistry: AMPD2 Antibody [NBP2-48971] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AMPD2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RRKGLDVAEPGPSRCRSDSPAVAAVVPAMASYPSGSGKPKAKYPFKKRASLQASTAAPEARGGLGAPPLQSARSLPGPAPCLKHFPL
Specificity
Specificity of human AMPD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AMPD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AMPD2 Recombinant Protein Antigen (NBP2-48971PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AMPD2 Antibody

  • adenosine monophosphate deaminase 2 (isoform L)
  • adenosine monophosphate deaminase 2
  • AMP deaminase 2
  • AMP deaminase isoform L
  • AMPD
  • EC 3.5.4.6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
NBP2-49690
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-14290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82541
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1905
Species: Mu
Applications: WB
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB100-239
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005564-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03523
Species: Hu, Ca
Applications: WB, Flow

Publications for AMPD2 Antibody (NBP2-48971) (0)

There are no publications for AMPD2 Antibody (NBP2-48971).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMPD2 Antibody (NBP2-48971) (0)

There are no reviews for AMPD2 Antibody (NBP2-48971). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AMPD2 Antibody (NBP2-48971) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for AMPD2 Antibody (NBP2-48971)

Discover related pathways, diseases and genes to AMPD2 Antibody (NBP2-48971). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMPD2 Antibody (NBP2-48971)

Discover more about diseases related to AMPD2 Antibody (NBP2-48971).
 

Pathways for AMPD2 Antibody (NBP2-48971)

View related products by pathway.

PTMs for AMPD2 Antibody (NBP2-48971)

Learn more about PTMs related to AMPD2 Antibody (NBP2-48971).

Blogs on AMPD2

There are no specific blogs for AMPD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AMPD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AMPD2