Aminopeptidase P2/XPNPEP2 Antibody

Images

 
Western Blot: Aminopeptidase P2/XPNPEP2 Antibody [NBP1-80493] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Aminopeptidase P2/XPNPEP2 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human XPNPEP2. Peptide sequence QALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
XPNPEP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against XPNPEP2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Aminopeptidase P2/XPNPEP2 Antibody

  • Aminoacylproline aminopeptidase
  • Aminopeptidase P2
  • APP2
  • EC 3.4.11.9
  • mAmP
  • Membrane-bound aminopeptidase P
  • Membrane-bound AmP
  • Membrane-bound APP
  • xaa-Pro aminopeptidase 2
  • XPNPEP2
  • X-Pro aminopeptidase 2
  • X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-89993
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-80613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB100-74593
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-94203
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF1182
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-86072
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB931
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB110-58360
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-89029
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP1-80493
Species: Hu
Applications: WB

Publications for Aminopeptidase P2/XPNPEP2 Antibody (NBP1-80493) (0)

There are no publications for Aminopeptidase P2/XPNPEP2 Antibody (NBP1-80493).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aminopeptidase P2/XPNPEP2 Antibody (NBP1-80493) (0)

There are no reviews for Aminopeptidase P2/XPNPEP2 Antibody (NBP1-80493). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aminopeptidase P2/XPNPEP2 Antibody (NBP1-80493) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Aminopeptidase P2/XPNPEP2 Antibody (NBP1-80493)

Discover related pathways, diseases and genes to Aminopeptidase P2/XPNPEP2 Antibody (NBP1-80493). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aminopeptidase P2/XPNPEP2 Antibody (NBP1-80493)

Discover more about diseases related to Aminopeptidase P2/XPNPEP2 Antibody (NBP1-80493).
 

Pathways for Aminopeptidase P2/XPNPEP2 Antibody (NBP1-80493)

View related products by pathway.

PTMs for Aminopeptidase P2/XPNPEP2 Antibody (NBP1-80493)

Learn more about PTMs related to Aminopeptidase P2/XPNPEP2 Antibody (NBP1-80493).

Blogs on Aminopeptidase P2/XPNPEP2

There are no specific blogs for Aminopeptidase P2/XPNPEP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aminopeptidase P2/XPNPEP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol XPNPEP2
Uniprot