Aminopeptidase P2/XPNPEP2 Antibody - BSA Free

Western Blot: Aminopeptidase P2/XPNPEP2 Antibody [NBP1-80493] - 293T cells lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Aminopeptidase P2/XPNPEP2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human XPNPEP2. Peptide sequence QALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: XPNPEP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Aminopeptidase P2/XPNPEP2 Antibody - BSA Free

• Aminoacylproline aminopeptidase
• Aminopeptidase P2
• APP2
• EC 3.4.11.9
• mAmP
• Membrane-bound aminopeptidase P
• Membrane-bound AmP
• Membrane-bound APP
• xaa-Pro aminopeptidase 2
• XPNPEP2
• X-Pro aminopeptidase 2
• X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound

Background

Aminopeptidase P is a hydrolase specific for N-terminal imido bonds, which are common to several collagen degradation products, neuropeptides, vasoactive peptides, and cytokines. Structurally, the enzyme is a member of the 'pita bread fold' family and occurs in mammalian tissues in both soluble and GPI-anchored membrane-bound forms. A membrane-bound and soluble form of this enzyme have been identified as products of two separate genes. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: XPNPEP2
• Uniprot:
  • NP_003390(Human)