Aminopeptidase N/CD13 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: PNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQA |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ANPEP |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Simple Western 1:25
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Aminopeptidase N/CD13 Antibody
Background
Alanine aminopeptidase (CD13) is expressed on the majority of peripheral blood monocytes and granulocytes. CD13 is also expressed by the majority of acute myeloid leukemias, chronic myeloid leukemias in myeloid blast crisis, a smaller percentage of lymphoid leukemias and myeloid cell lines. CD13 is also found in several types of non hematopoietic cells such as fibroblasts and endothelial cells and in a soluble form in blood plasma. CD13 is not expressed on B cells, T cells, platelets or erythrocytes. In the mouse, CD13 is a non-covalently linked homodimer of approximately 150kD subunits expressed by a variety of cells including monocytes, macrophages, dendritic cell and veiled cells. CD13 plays a role in biologically active peptide metabolism, in the control of growth and differentiation, in phagocytosis and in bactericidal/tumoricidal activities. CD13 also serves as a receptor for human coronaviruses.
CD13 is commonly used as a biomarker to detect damage to the kidneys, and that may be used to help diagnose certain kidney disorders. Therefore, CD13 antibodies are useful tools for cancer and renal disorder research.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Rt
Applications: IHC, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IHC-P, IP
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IMC, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC
Publications for Aminopeptidase N/CD13 Antibody (NBP2-33855) (0)
There are no publications for Aminopeptidase N/CD13 Antibody (NBP2-33855).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Aminopeptidase N/CD13 Antibody (NBP2-33855) (0)
There are no reviews for Aminopeptidase N/CD13 Antibody (NBP2-33855).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Aminopeptidase N/CD13 Antibody (NBP2-33855) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Aminopeptidase N/CD13 Products
Research Areas for Aminopeptidase N/CD13 Antibody (NBP2-33855)
Find related products by research area.
|
Blogs on Aminopeptidase N/CD13