Aminopeptidase N/CD13 Antibody

Images

 
Western Blot: Aminopeptidase N/CD13 Antibody [NBP2-33855] - Analysis in human small intestine tissue.
Immunocytochemistry/ Immunofluorescence: Aminopeptidase N/CD13 Antibody [NBP2-33855] - Staining of human cell line BJ shows localization to nucleus & plasma membrane.
Immunohistochemistry-Paraffin: Aminopeptidase N/CD13 Antibody [NBP2-33855] - Immunohistochemical staining of human kidney shows distinct membranous and cytoplasmic positivity in tubular cells.
Simple Western: Aminopeptidase N/CD13 Antibody [NBP2-33855] - Simple Western lane view shows a specific band for Aminopeptidase N/CD13 in 0.2 mg/ml of HEL (left) and H. Kidney (right) lysate(s). This experiment was ...read more
Simple Western: Aminopeptidase N/CD13 Antibody [NBP2-33855] - Electropherogram image of the corresponding Simple Western lane view. Aminopeptidase N/CD13 antibody was used at 1:25 dilution on HEL and H. Kidney lysate(s) ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Aminopeptidase N/CD13 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANPEP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Simple Western 1:25
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Aminopeptidase N/CD13 Protein (NBP2-33855PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Aminopeptidase N/CD13 Antibody

  • alanyl (membrane) aminopeptidase
  • Alanyl aminopeptidase
  • Aminopeptidase M
  • Aminopeptidase N
  • ANPEP
  • AP-M
  • APN
  • AP-N
  • CD13 antigen
  • CD13
  • CD13APN
  • EC 3.4.11
  • EC 3.4.11.2
  • gp150
  • LAP1
  • Microsomal aminopeptidase
  • Myeloid plasma membrane glycoprotein CD13
  • p150
  • PEPN
  • PEPNhAPN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1885
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
AF7579
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for Aminopeptidase N/CD13 Antibody (NBP2-33855) (0)

There are no publications for Aminopeptidase N/CD13 Antibody (NBP2-33855).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aminopeptidase N/CD13 Antibody (NBP2-33855) (0)

There are no reviews for Aminopeptidase N/CD13 Antibody (NBP2-33855). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Aminopeptidase N/CD13 Antibody (NBP2-33855) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aminopeptidase N/CD13 Products

Bioinformatics Tool for Aminopeptidase N/CD13 Antibody (NBP2-33855)

Discover related pathways, diseases and genes to Aminopeptidase N/CD13 Antibody (NBP2-33855). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aminopeptidase N/CD13 Antibody (NBP2-33855)

Discover more about diseases related to Aminopeptidase N/CD13 Antibody (NBP2-33855).
 

Pathways for Aminopeptidase N/CD13 Antibody (NBP2-33855)

View related products by pathway.

Research Areas for Aminopeptidase N/CD13 Antibody (NBP2-33855)

Find related products by research area.

Blogs on Aminopeptidase N/CD13

There are no specific blogs for Aminopeptidase N/CD13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aminopeptidase N/CD13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANPEP
Entrez
Uniprot