Aminopeptidase N/CD13 Antibody

Western Blot: Aminopeptidase N/CD13 Antibody [NBP2-33855] - Analysis in human small intestine tissue.

Immunocytochemistry/Immunofluorescence: Aminopeptidase N/CD13 Antibody [NBP2-33855] - Staining of human cell line BJ shows localization to plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Aminopeptidase N/CD13 Antibody [NBP2-33855] - Staining of human small intestine shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Aminopeptidase N/CD13 Antibody [NBP2-33855] - Analysis in human small intestine and fallopian tube tissues. Corresponding ANPEP RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Aminopeptidase N/CD13 Antibody [NBP2-33855] - Staining of human pancreas shows strong membranous positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: Aminopeptidase N/CD13 Antibody [NBP2-33855] - Staining of human kidney shows strong membranous positivity in cells in tubules.

Immunohistochemistry-Paraffin: Aminopeptidase N/CD13 Antibody [NBP2-33855] - Staining of human fallopian tube shows no positivity in glandular cells as expected.

Simple Western: Aminopeptidase N/CD13 Antibody [NBP2-33855] - Simple Western lane view shows a specific band for Aminopeptidase N/CD13 in 0.2 mg/ml of HEL (left) and H. Kidney (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.

Simple Western: Aminopeptidase N/CD13 Antibody [NBP2-33855] - Electropherogram image of the corresponding Simple Western lane view. Aminopeptidase N/CD13 antibody was used at 1:25 dilution on HEL and H. Kidney lysate(s) respectively.

Product Discontinued

Aminopeptidase N/CD13 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANPEP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Simple Western 1:25
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Aminopeptidase N/CD13 Recombinant Protein Antigen (NBP2-33855PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Aminopeptidase N/CD13 Antibody

• alanyl (membrane) aminopeptidase
• Alanyl aminopeptidase
• Aminopeptidase M
• Aminopeptidase N
• ANPEP
• AP-M
• APN
• AP-N
• CD13 antigen
• CD13
• CD13APN
• EC 3.4.11
• EC 3.4.11.2
• gp150
• LAP1
• Microsomal aminopeptidase
• Myeloid plasma membrane glycoprotein CD13
• p150
• PEPN
• PEPNhAPN

Background

Alanine aminopeptidase (CD13) is expressed on the majority of peripheral blood monocytes and granulocytes. CD13 is also expressed by the majority of acute myeloid leukemias, chronic myeloid leukemias in myeloid blast crisis, a smaller percentage of lymphoid leukemias and myeloid cell lines. CD13 is also found in several types of non hematopoietic cells such as fibroblasts and endothelial cells and in a soluble form in blood plasma. CD13 is not expressed on B cells, T cells, platelets or erythrocytes. In the mouse, CD13 is a non-covalently linked homodimer of approximately 150kD subunits expressed by a variety of cells including monocytes, macrophages, dendritic cell and veiled cells. CD13 plays a role in biologically active peptide metabolism, in the control of growth and differentiation, in phagocytosis and in bactericidal/tumoricidal activities. CD13 also serves as a receptor for human coronaviruses.

CD13 is commonly used as a biomarker to detect damage to the kidneys, and that may be used to help diagnose certain kidney disorders. Therefore, CD13 antibodies are useful tools for cancer and renal disorder research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANPEP
• Uniprot:
  • P15144()