Home » ALG12 » ALG12 Antibodies » ALG12 Antibody

ALG12 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ALG12 Antibody [NBP2-86977] - Host: Rabbit. Target Name: ALG12. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Western Blot: ALG12 Antibody [NBP2-86977] - Host: Rabbit. Target Name: ALG12. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ALG12 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ALG12. Peptide sequence: EESFNLQATHDLLYHWQDLEQYDHLEFPGVVPRTFLGPVVIAVFSSPAVY The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ALG12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALG12 Antibody

  • alpha-1,6-mannosyltransferase)
  • asparagine-linked glycosylation 12 homolog (S. cerevisiae
  • asparagine-linked glycosylation 12 homolog (yeast
  • asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S.cerevisiae)
  • Asparagine-linked glycosylation protein 12 homolog
  • CDG1G
  • dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase
  • dolichyl-P-mannose:Man-7-GlcNAc-2-PP-dolichyl-alpha-6-mannosyltransferase
  • EC 2.4.1.-
  • ECM39
  • hALG12
  • Mannosyltransferase ALG12 homolog
  • Membrane protein SB87
  • MGC111358
  • MGC3136
  • PP14673

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ALG9 Antibody
NBP1-90191
Immunohistochemistry-Paraffin: ALG9 Antibody [NBP1-90191] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunocytochemistry/Immunofluorescence: ALG9 Antibody [NBP1-90191] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SYS1 Antibody
NBP2-13407
Immunohistochemistry-Paraffin: SYS1 Antibody [NBP2-13407] - Staining of human ovary shows nuclear positivity.
Immunohistochemistry-Paraffin: SYS1 Antibody [NBP2-13407] - Staining of human cerebellum shows weak granular cytoplasmic positivity in Purkinje cells.
Immunohistochemistry: SYS1 Antibody [NBP2-13407] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: IHC, IHC-P

PMM2/Phosphomannomutas
NBP2-57753
Immunohistochemistry-Paraffin: PMM2/Phosphomannomutase 2 Antibody [NBP2-57753] - Staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.
Western Blot: PMM2/Phosphomannomutase 2 Antibody [NBP2-57753] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/Immunofluorescence: PMM2/Phosphomannomutase 2 Antibody [NBP2-57753] - Staining of human cell line SH-SY5Y shows localization to nucleus & cytosol.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
VPS39 Antibody -
BSA Free
NBP1-76535
Immunocytochemistry/Immunofluorescence: VPS39 Antibody [NBP1-76535] - Mouse liver tissue.
Immunocytochemistry/Immunofluorescence: VPS39 Antibody [NBP1-76535] - Saos2 Cells, anti-VPS39 primary, Hoescht33342, anti-Rabbit alexa594 secondary. Image from verified customer review.
Immunohistochemistry-Paraffin: VPS39 Antibody [NBP1-76535] - Mouse liver tissue with VPS39 antibody at 5 ug/mL.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
VPS53 Antibody
NBP1-83798
Immunohistochemistry-Paraffin: VPS53 Antibody [NBP1-83798] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: VPS53 Antibody [NBP1-83798] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: VPS53 Antibody [NBP1-83798] - Staining in human cerebral cortex and pancreas tissues using anti-VPS53 antibody. Corresponding VPS53 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CRELD2 Antibody
AF3686
CRELD2 Antibody
(2 Publications)
Species: Mu
Applications: WB
Holo-Transferrin
2914-HT
Holo-Transferrin
(4 Reviews)
(34 Publications)
Species: Hu
Applications: BA
Cytokeratin 14
Antibody (LL002)
NBP2-34270
Flow Cytometry: Cytokeratin 14 Antibody (LL002) [NBP2-34270] - Flow Cytometric Analysis of trypsinized MeOH-fixed HeLa cells using Cytokeratin 14 Antibody (LL002) followed by Goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
Immunocytochemistry/Immunofluorescence: Cytokeratin 14 Antibody (LL002) [NBP2-34270] - Immunofluorescence Analysis of A549 cells labeling CK14 with Cytokeratin 14 Antibody (LL002) followed by Goat anti-Mouse IgG-CF488 (Green). The nuclear counterstain is Red Dot (Red).
Immunohistochemistry-Paraffin: Cytokeratin 14 Antibody (LL002) [NBP2-34270] - Formalin-fixed, paraffin-embedded human Prostate Carcinoma stained with Cytokeratin 14 Antibody (LL002).
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western
PIGB Antibody
NBP1-85856
Immunohistochemistry-Paraffin: PIGB Antibody [NBP1-85856] - Staining of human rectum shows strong nuclear and cytoplasmic positivity in glandular cells.
Western Blot: PIGB Antibody [NBP1-85856] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Western Blot: PIGB Antibody [NBP1-85856] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Dolichol Kinase
Antibody
NBP2-68873
Western Blot: Dolichol Kinase Antibody [NBP2-68873] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/Immunofluorescence: Dolichol Kinase Antibody [NBP2-68873] - Staining of human cell line HaCaT shows localization to nucleus, nucleoli & cytosol.
Species: Hu
Applications: ICC/IF, WB
DPM1 Antibody
NBP1-05034
Immunohistochemistry-Paraffin: DPM1 Antibody [NBP1-05034] - (3.75ug/ml) staining of paraffin embedded Human Tonsil. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: DPM1 Antibody [NBP1-05034] - (0.1ug/ml) staining of Human Liver lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
GLI-2 Antibody
AF3635
GLI‑2 was detected in immersion fixed frozen sections of mouse embryo (15 d.p.c.) using Goat Anti-Mouse GLI‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3635) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling when primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. Specific staining was localized to developing muscle. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(5 Reviews)
(16 Publications)
Species: Mu
Applications: IHC, WB
AGFG2 Antibody
NBP1-83213
Immunohistochemistry-Paraffin: AGFG2 Antibody [NBP1-83213] - Staining of human salivary gland shows high expression.
Immunohistochemistry-Paraffin: AGFG2 Antibody [NBP1-83213] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: AGFG2 Antibody [NBP1-83213] - Staining in human salivary gland and skeletal muscle tissues using anti-AGFG2 antibody. Corresponding AGFG2 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P, WB
SLPI [HRP]
DPI00
(31 Publications)
Species: Hu
Applications: ELISA
Niemann-Pick C1
Antibody - BSA Free
NB400-148
Knockout Validated: Niemann-Pick C1 Antibody [NB400-148] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and NPC1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Rabbit Anti-Human NPC1 Polyclonal Antibody (Catalog # NB400-148) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for NPC1 at approximately 240-260 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Niemann-Pick C1 Antibody [NB400-148] - Protein expression analysis of normal and NPC-deficient cells after HIV-1 infection. Cells were uninfected or infected with VSVG-HIV-1 and harvested 96 h post-infection. NPC2, NPC1, and beta-actin protein expression was detected via Western blotting in uninfected and infected cells. Gag expression was also detected in the infected cells. Image collected and cropped by CiteAb from the following publication (http://virologyj.biomedcentral.com/articles/10.1186/1743-422X-9-31), licensed under a CC-BY licence.
Knockdown Validated: Niemann-Pick C1 Antibody [NB400-148] - HeLa lysate, BHK lysate, A431 lysate tested at 1:1000. Image from verified customer review.
(6 Reviews)
(47 Publications)
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
Cathepsin
A/Lysosomal Carboxype ...
AF1049
Cathepsin A/Lysosomal Carboxypeptidase A was detected in immersion fixed paraffin-embedded sections of human prostate using Goat Anti-Human Cathepsin A/Lysosomal Carboxypeptidase A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1049) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(4 Publications)
Species: Hu
Applications: IHC, WB
Recombinant Human
PIGZ GST (N-Term) Pro ...
H00080235-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
PDCD6 Antibody
[Unconjugated]
AF6015
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, Hepa 1‑6 mouse hepatoma cell line, and NRK rat normal kidney cell line. PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse/Rat PDCD6 Polyclonal Antibody (Catalog # AF6015) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for PDCD6 at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Species: Hu, Mu, Rt
Applications: WB
ATF6 Antibody
(70B1413.1) - BSA Fre
NBP1-40256
Western Blot: ATF6 Antibody (70B1413.1) [NBP1-40256] - Hypoxia leads to EMT and ER-stress in CRC cells. B. C. Confluent growing SW480 (B) and HCT116 (C) cells were cultured under conditions of normoxia or hypoxia-like conditions (serum free; 100 uM CoCl2, 1-9 h. B-actin (B-act) as loading control. HIF1a was detectable after 3 h of CoCl2 incubation, the amount of the 50 kD-ATF6 fragment, was already enhanced after 1 h of addition of CoCl2. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0087386) licensed under a CC-BY licence.
Flow (Intracellular): ATF6 Antibody (70B1413.1) [NBP1-40256] - An intracellular stain was performed on HeLa cells with ATF6 Antibody (70B1413.1) NBP1-40256F (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to FITC.. Using the FITC format of this antibody.
Immunohistochemistry-Paraffin: ATF6 Antibody (70B1413.1) [NBP1-40256] - Analysis of ATF6 antibody on Human placenta. Fixed paraffin-embedded sections. Antibody dilution 1:50. Incubated overnight in 4C. Image from verified customer review.
(3 Reviews)
(216 Publications)
Species: Hu, Mu, Pl, Po, Rb, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
ALG12 Antibody
NBP2-86977
ALG12 Antibody
Species: Hu
Applications: WB

Publications for ALG12 Antibody (NBP2-86977) (0)

There are no publications for ALG12 Antibody (NBP2-86977).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALG12 Antibody (NBP2-86977) (0)

There are no reviews for ALG12 Antibody (NBP2-86977). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALG12 Antibody (NBP2-86977) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALG12 Products

Array NBP2-86977

Bioinformatics Tool for ALG12 Antibody (NBP2-86977)

Discover related pathways, diseases and genes to ALG12 Antibody (NBP2-86977). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALG12 Antibody (NBP2-86977)

Discover more about diseases related to ALG12 Antibody (NBP2-86977).
 

Pathways for ALG12 Antibody (NBP2-86977)

View related products by pathway.

PTMs for ALG12 Antibody (NBP2-86977)

Learn more about PTMs related to ALG12 Antibody (NBP2-86977).

Blogs on ALG12

There are no specific blogs for ALG12, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALG12 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ALG12