ALG12 Antibody

Images

 
Western Blot: ALG12 Antibody [NBP2-86977] - Host: Rabbit. Target Name: ALG12. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALG12 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ALG12. Peptide sequence: EESFNLQATHDLLYHWQDLEQYDHLEFPGVVPRTFLGPVVIAVFSSPAVY The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ALG12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALG12 Antibody

  • alpha-1,6-mannosyltransferase)
  • asparagine-linked glycosylation 12 homolog (S. cerevisiae
  • asparagine-linked glycosylation 12 homolog (yeast
  • asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S.cerevisiae)
  • Asparagine-linked glycosylation protein 12 homolog
  • CDG1G
  • dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase
  • dolichyl-P-mannose:Man-7-GlcNAc-2-PP-dolichyl-alpha-6-mannosyltransferase
  • EC 2.4.1.-
  • ECM39
  • hALG12
  • Mannosyltransferase ALG12 homolog
  • Membrane protein SB87
  • MGC111358
  • MGC3136
  • PP14673

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90191
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13407
Species: Hu
Applications: IHC, IHC-P
NBP2-57753
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-76535
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-83798
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3686
Species: Mu
Applications: WB
2914-HT
Species: Hu
Applications: BA
NBP2-34270
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western
NBP1-85856
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-68873
Species: Hu
Applications: ICC/IF, WB
NBP1-05034
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
AF3635
Species: Mu
Applications: IHC, WB
NBP1-83213
Species: Hu
Applications: IHC, IHC-P, WB
DPI00
Species: Hu
Applications: ELISA
NB400-148
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
AF1049
Species: Hu
Applications: IHC, WB
H00080235-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF6015
Species: Hu, Mu, Rt
Applications: WB
NBP1-40256
Species: Hu, Mu, Pl, Po, Rb, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
NBP2-86977
Species: Hu
Applications: WB

Publications for ALG12 Antibody (NBP2-86977) (0)

There are no publications for ALG12 Antibody (NBP2-86977).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALG12 Antibody (NBP2-86977) (0)

There are no reviews for ALG12 Antibody (NBP2-86977). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALG12 Antibody (NBP2-86977) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALG12 Products

Array NBP2-86977

Bioinformatics Tool for ALG12 Antibody (NBP2-86977)

Discover related pathways, diseases and genes to ALG12 Antibody (NBP2-86977). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALG12 Antibody (NBP2-86977)

Discover more about diseases related to ALG12 Antibody (NBP2-86977).
 

Pathways for ALG12 Antibody (NBP2-86977)

View related products by pathway.

PTMs for ALG12 Antibody (NBP2-86977)

Learn more about PTMs related to ALG12 Antibody (NBP2-86977).

Blogs on ALG12

There are no specific blogs for ALG12, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALG12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALG12