ALDH1L2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ALDH1L2 Antibody [NBP2-68750] - Staining of human cell line BJ shows localization to mitochondria.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ALDH1L2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KCGGLQLQNEDVYMATKFEGFIQKVVRKLRGEDQEVELVVDYISKEVNEIMVKMPYQCFINGQFTDADDGKT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ALDH1L2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  ALDH1L2 Recombinant Protein Antigen (NBP2-68750PEP)

Reactivity Notes

Rat 85%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for ALDH1L2 Antibody - BSA Free

• aldehyde dehydrogenase 1 family, member L2
• aldehyde dehydrogenase family 1 member L2
• DKFZp686A16126
• DKFZp686M064
• EC 1.5.1.6
• FLJ36769
• FLJ38508
• MGC119536
• MGC119537,10-formyltetrahydrofolate dehydrogenase ALDH1L2
• Mitochondrial 10-formyltetrahydrofolate dehydrogenase
• mtFDHDKFZp686P14145
• probable 10-formyltetrahydrofolate dehydrogenase ALDH1L2

Background

The ALDH1L2 gene encodes a protein, which belongs to both the aldehyde dehydrogenase superfamily and the formyl transferasesuperfamily. Alternatively spliced transcript variants have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ALDH1L2